KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_23780Help
Entry
GTCCBUS3UF5_23780 CDS       T01676                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTCCBUS3UF5_23780
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTCCBUS3UF5_23780
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GTCCBUS3UF5_23780
Enzymes [BR:gte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GTCCBUS3UF5_23780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2189636..2190799)
Genome map
AA seq 387 aa AA seqDB search
MSVVQETKGYFGEFGGSFVPDELQEVLDYLEEQFLKYKDDPEFNEEFRTYLREYVGRESP
LTFAARLTERLGGAKIYLKREDLNHTGSHKINNVIGQILLAKRMGAKRVIAETGAGQHGV
ATATACAMFGIDCTIYMGEEDTKRQALNVFRMELLGAKVVSVSKGQGRLKDAVDEALNDL
VQNYKTTFYLLGSAVGPHPYPSMVKHFQSVISEESKRQIVEKEGRLPDAVVACVGGGSNA
IGAFAHYLDEPSVRLIGVEPEKAATLTKGVPAVLHGFKCLVLLDENGNPQPTYSIAAGLD
YPGIGPEHSYLKVSGRAEYYTVTNEEVLEAFQLLSKTEGIIPALESAHAVAYAIKLAPTL
SKDQIIIVNLSGRGDKDVEQVFSMLQS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagtccaggaaacgaaaggctatttcggcgaattcggcggcagcttcgttccg
gatgaattgcaggaagtgcttgattatttggaggagcagtttctgaaatataaagatgac
ccggaattcaatgaggagtttcgaacctatttgcgggagtatgtcggccgtgagagtccg
ctgacgtttgcggcgcggttgacggagcggctcggcggggcgaagatttatttgaaacgt
gaggatttaaaccataccggttcgcataaaatcaacaacgtgattgggcaaattttattg
gcgaagcggatgggcgcgaagcgggtcattgcggagacaggcgcaggccagcacggggtg
gcgaccgctaccgcatgcgccatgtttggcatcgattgtaccatttatatgggagaagaa
gatacgaagcgccaggcgctcaatgtgttccgcatggagctgttaggggcgaaagtcgtg
tcggtctcgaaaggtcaaggacgattgaaggatgccgtggacgaggcgctgaacgatctt
gtgcaaaactataagactacattttacttgcttggttcggcggttggtccgcatccgtac
ccgtcgatggtgaaacattttcagtcggttattagcgaagagagcaagcggcagattgta
gagaaggaaggacgtcttccggatgcggtagtggcctgcgtcggcgggggaagcaacgcc
atcggggcgttcgcccactacttggatgaaccgagcgtgcggctcatcggtgtcgagccg
gagaaggcagcgacgctaacgaagggcgttccggccgtgttgcatggattcaagtgtttg
gtgctccttgatgaaaatggaaacccgcagccgacatactcgattgccgccgggcttgat
tacccgggcattggtccggaacatagctacttgaaagtgtccgggcgggctgagtattat
acggtcacgaacgaagaagtgcttgaggcgtttcaactgctgtctaaaacagaaggaatc
atcccagctctcgagagcgcccatgcggtggcgtacgctatcaagcttgcgccgacgtta
agcaaagaccaaatcatcattgtgaatttgtcggggcgcggggataaggatgttgagcaa
gtgttttccatgttgcaatcgtga

DBGET integrated database retrieval system