KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_23780Help
Entry
GTCCBUS3UF5_23780 CDS       T01676                                 

Definition
(GenBank) hypothetical protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00260  Glycine, serine and threonine metabolism
gte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01130  Biosynthesis of antibiotics
gte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTCCBUS3UF5_23780
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GTCCBUS3UF5_23780
Enzymes [BR:gte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GTCCBUS3UF5_23780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEV19683
UniProt: G8MYC2
Position
complement(2189636..2190799)
Genome map
AA seq 387 aa AA seqDB search
MSVVQETKGYFGEFGGSFVPDELQEVLDYLEEQFLKYKDDPEFNEEFRTYLREYVGRESP
LTFAARLTERLGGAKIYLKREDLNHTGSHKINNVIGQILLAKRMGAKRVIAETGAGQHGV
ATATACAMFGIDCTIYMGEEDTKRQALNVFRMELLGAKVVSVSKGQGRLKDAVDEALNDL
VQNYKTTFYLLGSAVGPHPYPSMVKHFQSVISEESKRQIVEKEGRLPDAVVACVGGGSNA
IGAFAHYLDEPSVRLIGVEPEKAATLTKGVPAVLHGFKCLVLLDENGNPQPTYSIAAGLD
YPGIGPEHSYLKVSGRAEYYTVTNEEVLEAFQLLSKTEGIIPALESAHAVAYAIKLAPTL
SKDQIIIVNLSGRGDKDVEQVFSMLQS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtagtccaggaaacgaaaggctatttcggcgaattcggcggcagcttcgttccg
gatgaattgcaggaagtgcttgattatttggaggagcagtttctgaaatataaagatgac
ccggaattcaatgaggagtttcgaacctatttgcgggagtatgtcggccgtgagagtccg
ctgacgtttgcggcgcggttgacggagcggctcggcggggcgaagatttatttgaaacgt
gaggatttaaaccataccggttcgcataaaatcaacaacgtgattgggcaaattttattg
gcgaagcggatgggcgcgaagcgggtcattgcggagacaggcgcaggccagcacggggtg
gcgaccgctaccgcatgcgccatgtttggcatcgattgtaccatttatatgggagaagaa
gatacgaagcgccaggcgctcaatgtgttccgcatggagctgttaggggcgaaagtcgtg
tcggtctcgaaaggtcaaggacgattgaaggatgccgtggacgaggcgctgaacgatctt
gtgcaaaactataagactacattttacttgcttggttcggcggttggtccgcatccgtac
ccgtcgatggtgaaacattttcagtcggttattagcgaagagagcaagcggcagattgta
gagaaggaaggacgtcttccggatgcggtagtggcctgcgtcggcgggggaagcaacgcc
atcggggcgttcgcccactacttggatgaaccgagcgtgcggctcatcggtgtcgagccg
gagaaggcagcgacgctaacgaagggcgttccggccgtgttgcatggattcaagtgtttg
gtgctccttgatgaaaatggaaacccgcagccgacatactcgattgccgccgggcttgat
tacccgggcattggtccggaacatagctacttgaaagtgtccgggcgggctgagtattat
acggtcacgaacgaagaagtgcttgaggcgtttcaactgctgtctaaaacagaaggaatc
atcccagctctcgagagcgcccatgcggtggcgtacgctatcaagcttgcgccgacgtta
agcaaagaccaaatcatcattgtgaatttgtcggggcgcggggataaggatgttgagcaa
gtgttttccatgttgcaatcgtga

DBGET integrated database retrieval system