KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_24350Help
Entry
GTCCBUS3UF5_24350 CDS       T01676                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gte  Geobacillus thermoleovorans
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    GTCCBUS3UF5_24350
  Lipid metabolism
   00561 Glycerolipid metabolism
    GTCCBUS3UF5_24350
   00600 Sphingolipid metabolism
    GTCCBUS3UF5_24350
Enzymes [BR:gte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     GTCCBUS3UF5_24350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2247412..2249601)
Genome map
AA seq 729 aa AA seqDB search
MAVTYNPQTKQFHLRAGKASYVMQLFRSGYLAHIYWGKAVRDVRGERRFSRLDRAFSPNL
APSDRTFSLDTLPQEYPAYGNTDFRSPAYQVQLENGSTVTDLRYKTHRIYKGKPRLNGLP
ATYVEHEQEAETLEIVLGDALIGLEVTLQYTAYEKWNVITRAARFENKGGERLKLLRALS
MSVDFPTADYDWIHLPGAWGRERWIERRPLVTGVQAAESRRGASSHQQNPFIALVAKNAD
EHQGEVYGFSFVYSGNFLAQIEVDQFGTARVSMGINPFDFTWLLQPGESFQTPEVVMVYS
DQGLNGMSQTYHELYRTRLARGAFRDRERPILINNWEATYFDFNEEKLVNIAKTAAKLGI
ELFVLDDGWFGERDDDRRSLGDWIVNRRKLPNGLDGLAKQVNELGLQFGLWVEPEMVSPN
SELYRKHPDWCLHVPNRPRSEGRNQLVLDYSREDVCDYIIETISNVLASAPITYVKWDMN
RHMTEIGSSALPPERQRETAHRYMLGLYRVMDEMTSRFPHILFESCSGGGGRFDPGMLYY
MPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVGRVTSLKTRGHVAMSGN
FGYELDITKLTETEKQMIKQQVAFYKDVRRLVQFGTFYRLLSPFEGNEAAWMFVSADRSE
ALVAYFRVLAEANAPLSYLRLKGLDPNQDYEIEGLGVYGGDELMYAGVALPYRSGDFISM
MWRLKAVQR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcggttacatacaatccgcaaacgaagcagtttcatttgcgggcgggcaaggcaagc
tacgtgatgcagcttttccgctccggctatttggctcatatctattggggaaaagcggtg
cgcgatgttcggggggagcggaggttttcgcggctggatcgcgcgttttcccccaatctc
gccccatccgaccgcacgttttcgctcgatacgctgccgcaagaatatccggcctatggg
aataccgattttcgttctccggcgtatcaagtgcagcttgagaacggctcgaccgtgacc
gatttgcgctacaaaacgcaccgcatttacaaagggaagcctagacttaacggactgccg
gcgacatacgtggagcatgaacaggaagcggagacgctcgaaattgtccttggagatgcg
ctgatcggtctagaggtcacgttgcagtatacggcgtatgaaaaatggaacgtcatcacg
cgcgcggcccgttttgaaaacaaaggcggcgagcggttgaaactgctgcgtgcgctcagt
atgagcgttgatttcccaactgctgactatgattggatccatctccccggagcgtggggg
cgcgagcgctggatcgagcgccgcccgcttgtgaccggcgtgcaagcggcggaaagccgc
cgcggcgcgagcagccaccaacaaaacccatttatcgcgctcgtcgccaaaaacgccgat
gaacaccaaggcgaagtatacgggttcagctttgtgtacagcggcaattttctcgcccaa
atcgaggtggaccagttcggcactgcccgtgtctcgatgggaatcaacccgtttgatttc
acatggctgcttcagccgggtgagtcgttccaaacgccggaagtggtcatggtttactcc
gaccaagggttgaacgggatgtcgcaaacctaccacgaactgtaccgcacccgcctggcg
cgcggcgcattccgcgaccgcgaacgcccgattttgatcaacaactgggaagcaacgtac
ttcgattttaacgaagaaaaactcgtcaacattgcgaaaacggcagcgaaactaggcatc
gaactgtttgtgcttgacgacggctggtttggcgagcgcgatgacgaccgccggtcgctc
ggcgattggatcgtcaaccggcgcaagcttccgaacggcttggacgggctggcaaaacaa
gtaaacgaacttggactccagttcggcttatgggtcgaaccggaaatggtgtcgccaaac
agcgaactgtaccggaaacaccccgactggtgtctgcatgtgcccaaccgcccgcgttcg
gaaggacgaaaccagcttgtgctcgattattcccgcgaagacgtttgcgactatatcatc
gagacgatctcgaacgtcctcgcaagcgcgccgatcacgtacgtgaaatgggacatgaac
cgccatatgacggaaataggctcctccgccctgccgcccgagcgccagcgcgaaacggcg
caccgctatatgcttgggctgtaccgcgtcatggacgagatgacctcgcgctttccgcac
attttgtttgaaagctgttcgggaggcggggggcggtttgacccggggatgctgtattat
atgccgcaaacgtggacgagcgacaataccgatgccgtctcgcgcctgaaaattcaatac
ggcacgagcctcgtctatccgattagtgcaatgggcgcccacgtctcggcggtgccgaac
caccaagtcgggcgggtgacgtcgctcaagacgcgcggccatgtcgcgatgtcaggcaac
ttcggctatgagctcgatatcacgaaattgacggaaacagaaaaacaaatgattaagcaa
caagtcgcgttttacaaggacgtgcgccgtctcgtccagttcggcacgttttatcgactg
ctaagcccgtttgaaggcaacgaggcggcgtggatgttcgtctctgccgaccgctcggaa
gcgctcgtcgcctacttccgcgttctggccgaagcgaacgcgccgctgtcatacctgcgc
ttaaaagggcttgacccgaatcaagactacgaaatcgagggacttggcgtttacggcggc
gacgagctgatgtatgccggagtggccttgccgtaccgctctggcgattttatcagcatg
atgtggcgattgaaagctgttcaacgataa

DBGET integrated database retrieval system