KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_24860Help
Entry
GTCCBUS3UF5_24860 CDS       T01676                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTCCBUS3UF5_24860
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GTCCBUS3UF5_24860
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GTCCBUS3UF5_24860
Enzymes [BR:gte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GTCCBUS3UF5_24860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2289268..2290074)
Genome map
AA seq 268 aa AA seqDB search
MPLSVNPPLFIPFIVAGDPAPDVTIDLALALEEAGADILELGVPYSDPLADGPTIQRAAA
RALDGGMTLPKAIQLIGEMRKKGVNIPIILFTYYNPVLQLGEESFFALAQENGADGVLIP
DLPFEESGPLRELGERFGLPLISLVAPTSKQRIERIASAAQGFLYCVSSLGVTGVRETLP
ETLGDFLREVKRHSRVPVAVGFGISAPEQVAMLKEVCDGVVVGSALVQKVEQLAPRLQAP
DEREAAVAEFSAYARSLAAPLREAYSSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgccactgtccgttaatccgccgctatttatcccgtttatcgttgccggtgatccggct
cccgatgtgacgatcgatctcgccttggcgcttgaggaggccggcgctgacatattagag
cttggcgtgccgtactccgacccgctcgctgacggaccgacgattcaacgcgccgccgca
agggcgcttgacgggggcatgacgctgccgaaagccattcagcttattggcgagatgcga
aaaaaaggggtaaacattccgattattctctttacgtattacaatcctgtgttacaatta
ggagaagaatccttttttgctttagcgcaggaaaatggcgccgacggcgtgctcattccc
gatttgccgtttgaggaaagcggtccgctccgcgaacttggcgaacggtttggtctcccg
ctcatttcgcttgttgcgccgacgtcgaagcagcggatcgagcggatcgcttcggcggcg
caagggtttttgtattgcgtctcctcgctaggcgttacaggcgtgcgtgagacgctgccg
gagacgctcggcgatttcctccgcgaagtgaagcggcatagccgcgtcccggtcgccgtc
ggctttggcatttcggcgccggagcaagtcgcgatgttgaaagaggtgtgcgacggcgtt
gtcgtcggcagcgcactcgtgcaaaaagtcgagcagctggctccgaggttgcaggcgccg
gacgaaagggaagcggccgtcgccgagttttctgcctacgcccgttcgcttgccgcgccg
cttcgagaagcctattcttcgcgctaa

DBGET integrated database retrieval system