KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_24900Help
Entry
GTCCBUS3UF5_24900 CDS       T01676                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01130  Biosynthesis of antibiotics
gte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GTCCBUS3UF5_24900
Enzymes [BR:gte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     GTCCBUS3UF5_24900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NMO FMN_dh
Motif
Other DBs
NCBI-ProteinID: AEV19793
UniProt: G8MZM2
Position
complement(2292269..2293045)
Genome map
AA seq 258 aa AA seqDB search
MLEQILAAKREEVETLTLPAPLPERKRRPFAAALRRPRRMLGLIAEVKKASPSKGIIRPN
FDPVAIAKAYERAGADAISVLTDERYFQGHRRYLRAVKEAVNVPVLRKDFIIDRRQVEES
VRLGADAILLIGEALPPETLEELYHEAYSLGLECLVEVHAKETLERIFDRFTPEIVGINN
RDLHTFVTTLEATKTLAPLIPPSCVIVSESGIGSFNDVKTVKSYGAQAMLVGESLMRQDD
VERAVYRLFGEEDGDDSN
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagcaaattttagcagccaaacgggaagaagtggaaacgttgacgctgccggcg
ccattgccagagcgaaagcgccggccatttgcggcggcgctccgtcggccgcggcggatg
cttggcttgatcgctgaggtgaaaaaagcgtcgccgtcaaaaggcatcattcgcccgaat
tttgacccggtggccatcgcgaaagcatatgagcgcgccggtgccgacgcgatcagcgtg
ctgacggatgaacggtatttccaagggcatcgccgctatttgcgagcggtgaaagaagcg
gttaacgttcccgtgctgcgcaaagatttcatcatcgatcggcggcaagtcgaggaaagc
gtccgactcggggcggatgcgattttattgatcggcgaggcgctcccgccggaaacactc
gaggagctctatcatgaagcgtacagcttggggctcgaatgtctggtcgaggtgcatgca
aaagagacgctcgagcggattttcgatcggtttacgccggagatcgtcggcatcaacaac
cgcgacttgcatacctttgtgacaacacttgaggcgaccaaaacgctcgctccgctcatc
ccgccatcgtgcgtcatcgtcagcgaaagcgggatcggttccttcaatgatgtgaagacg
gtcaaatcgtacggagcgcaggccatgctcgtcggcgagtcgctcatgcgccaagatgat
gtggagcgagcggtctaccggctgtttggggaggaagatggggatgattcgaattaa

DBGET integrated database retrieval system