KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_28850Help
Entry
GTCCBUS3UF5_28850 CDS       T01676                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gte  Geobacillus thermoleovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GTCCBUS3UF5_28850
Enzymes [BR:gte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     GTCCBUS3UF5_28850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2634481..2636784)
Genome map
AA seq 767 aa AA seqDB search
MAVIFHNEETLYTVVRVRVEETNEAPVEEEVVVTGYFPRLNEGDVYIFYGQFRQHPRFGR
QYAASQFRKQLPNTKEGVIHYLSSGLFKGIGKKTAAAIVETLGENAIAAILRDPRALERV
PKLTKKKAKQLYDALRAHEGLEQTMIALAQLGFGPQLAMKIYQAYGEEAVDIIHENPYQL
VEDIEGIGFGRADEIGRQLGISGSHPARLRAASLFVLEQACLQEGHVYLREEELMERVGE
LLDGRLSGAVDGRAISQTLLMLSEEGKLIAEQGRYYLPSLYFAEKGIVSNIKRLLGQTPP
SAFAESEFLLALGALEERLGMQYAPQQREAIQQALSSPLFILTGGPGTGKTTVIKGIVEL
FAALNGLSLDPADYKQGEPFPVLLAAPTGRAAKRMSEATGLPAATIHRLLGWNGAEGFSR
DENEPISGKLLVIDEMSMVDTWLANQLLKAVPNGMQVIFVGDEDQLPSVGPGQVLKDLLS
SGVIPFARLTEVYRQAEGSSIIELAHEMKRGVVPDDLTAPKADRSFIRCRAGQVVDVVRQ
IADNARKKGFSVKDIQVLAPMYRGPAGIDQLNKALQELFNPPAEGKRELSVGEVVYRVGD
KVLQLVNQPEDNVFNGDIGEIVAIFYAKENIEKQDLLVVSFDGIEVTYTRQDLGQITHAY
CCSVHKAQGSEFPIVILPVVKSYYRMLKRNLLYTAVTRSKQFLVLCGEEEAFRFGVAKQS
DGARQTALAEKLAGAAAPFVEVELPFEEANMGMENVTPYDFMGDEPS
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
ttggcggtcatttttcataatgaggaaacattgtacacggtcgtccgcgtgcgcgttgag
gaaacgaacgaagcgcccgttgaggaggaagtcgtcgtcaccggctattttccgcgttta
aacgaaggggacgtctacatcttttacggacaattccgccaacatccgcgttttggccgc
caatatgcggctagtcagttccgcaaacagcttccgaacacgaaagaaggagtcattcat
tatttatcgagcggtttgtttaaaggaatcggcaaaaaaacggctgcggcgattgtcgag
acgctcggcgaaaacgcgatcgccgcgattttgcgcgaccccagggcgctagagcgtgtg
ccgaagctgacgaaaaaaaaggcgaagcagctgtacgatgcgcttcgcgcccacgaaggg
cttgagcaaacgatgatcgccctcgcccagctcggttttggcccgcagctggccatgaaa
atttaccaagcgtatggcgaagaagcggttgacatcatccacgagaacccgtaccagctc
gttgaggatatcgaagggatcggctttggccgcgctgatgaaatcgggcgccagctcggc
atttccggcagccatccggcccggctgcgcgccgcctcgttgtttgttcttgaacaggcg
tgcttgcaggaagggcacgtttatttgcgcgaggaagagctgatggagcgcgtcggggag
ctgcttgacggaaggctgagcggtgcggtggatggacgagcgatcagccaaacgcttctg
atgttaagcgaagaagggaagctgatcgccgagcaagggcgttattatctcccttccctt
tacttcgccgagaaagggatcgtctccaacattaagcggctgctcgggcagacgccgccg
tcggcgtttgccgagtcggagtttttgctggcgcttggggcgcttgaggaacggcttggc
atgcaatatgccccccagcaaagggaagcgatccaacaagcgctttcttcgccgctgttt
attttgaccggcggtccgggaacggggaaaacgacggtcatcaaaggcatcgtcgagctg
tttgccgccctaaacggcctgtctcttgacccggctgactacaaacaaggcgagccgttt
ccggtgctgctggccgcaccgaccggccgagcggcgaagcggatgagcgaggcgaccggg
ctgccggcggcgacgatccaccgcttgcttggctggaatggggcggaagggttcagccgc
gacgagaacgaaccgatttccggcaagctgcttgtcatcgatgagatgtcgatggtcgac
acgtggctcgccaaccagctgttaaaagccgtgccaaacggcatgcaagtcatttttgtc
ggcgatgaggatcaattgccatccgtcgggccagggcaagtgctgaaagacttgctctct
tcaggcgtcattccgttcgctcggttgaccgaggtgtatcgccaggcggaaggatcatcg
atcatcgagcttgctcatgagatgaagcgcggcgtcgtgccggacgatttgaccgctccg
aaggcagaccgttccttcatccgctgccgtgcgggccaggtcgtcgatgtcgtgcggcaa
atcgcggacaacgcgcgcaaaaaagggttttccgtcaaagatattcaagtgctcgccccg
atgtaccgtggtccagcgggcattgaccaattgaacaaagcgcttcaagagctgttcaac
ccgccggctgaggggaagcgggagctgtcggtcggtgaggtcgtctaccgcgtcggcgat
aaggtgctgcagctcgtcaatcaaccggaagacaatgtgtttaacggcgacatcggcgaa
atcgttgccattttttacgccaaagaaaatatcgaaaagcaagacttgctcgtcgtttcg
tttgatggcattgaagtgacgtacacacggcaagatttaggacaaatcacccatgcgtac
tgctgttcggttcataaggcgcaaggaagcgagtttccaatcgtcattttgcccgtcgtc
aaaagctattaccggatgttgaaacggaatttgttgtatactgcggtgacaagaagcaag
cagtttctcgttttatgcggggaagaggaagcgtttcgattcggcgtcgcaaaacaaagc
gacggagcgcgccagacggcgctcgctgagaagctggcgggggcggcggcgccgtttgtc
gaggtcgaactgccgtttgaagaggcgaacatggggatggaaaacgttacgccgtatgac
tttatgggcgatgagccaagctaa

DBGET integrated database retrieval system