KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_29160Help
Entry
GTCCBUS3UF5_29160 CDS       T01676                                 

Definition
holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
gte  Geobacillus thermoleovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GTCCBUS3UF5_29160
Enzymes [BR:gte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     GTCCBUS3UF5_29160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2670184..2670768)
Genome map
AA seq 194 aa AA seqDB search
MIEFIRGYVDYVCPEYIVIDHNGIGYEIFTPNPFAFQESREAAVTVYTYEYVREGVHALY
GFPTREERNLFAKLLQVSGIGPKGGLAILAAGRPDELARAIEEENEAFLCKFPGVGKKTA
RQMILDLKGKLGALAAPAAARSAAPLSGALAEAVAALKALGYAEREIEKIIPALREEAMS
TEQYVKRALALLLG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgagtttatccgtgggtatgtcgattacgtctgcccggaatatatcgtcatcgac
cataacggcatcggctacgagatctttacgccgaacccgtttgcgtttcaggaaagccgc
gaggcggcggtgaccgtctatacatacgaatatgtacgcgaaggtgtgcacgccttgtac
gggttcccaacgcgcgaggagcgcaacttgttcgccaagctgctgcaagtgtcgggcatc
gggccgaaaggcggcctcgccattttggcggccgggcgtccggatgaactggcgcgggcc
atcgaggaagaaaacgaggcgtttttatgcaagtttccaggcgtgggcaaaaagacggcc
cggcaaatgattttggatttaaaagggaagctcggggcgcttgcggcgccggcggctgca
cgttcggccgcaccgctttccggtgcgctcgccgaggcggtggcggcgctcaaggcgctc
ggctacgctgaacgggagatcgagaaaatcattccggcgctccgcgaagaagcgatgtcg
acggaacagtatgtgaagcgggcgctggcgctgcttttgggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system