KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_30250Help
Entry
GTCCBUS3UF5_30250 CDS       T01676                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00071  Fatty acid degradation
gte00362  Benzoate degradation
gte01100  Metabolic pathways
gte01120  Microbial metabolism in diverse environments
gte01212  Fatty acid metabolism
Module
gte_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    GTCCBUS3UF5_30250
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GTCCBUS3UF5_30250
Enzymes [BR:gte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     GTCCBUS3UF5_30250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEV20328
UniProt: G8N4A6
Position
complement(2778448..2779221)
Genome map
AA seq 257 aa AA seqDB search
MDFFRLAKEEFVAVVTFSRPPANALSSAVLKELSTVLDELETDPDVRVVLLHGEGRFFSA
GADIKEFTSIASVEEASGLSRNGQLVMERIERFSKPVIAAIHGAALGGGLELAMSCHIRV
VAENAKLGLPELQLGIIPGFAGTQRLVRYVGFGKAAEMMWTSEPITGLEAVEWGLANKAV
PEERLLDEAKALAKKIAAKSPLSVRATIELLNAAKEKSFAEAVREEAEWFGRVFVSEDAK
EGVQAFLEKRPPVFKGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggacttttttcgtttggcgaaagaggagttcgtcgccgtcgtgacgttttcgcggccg
ccggcgaacgccctttcatcagcggttttgaaagagctttcaaccgtgttggacgagctc
gagaccgacccggacgtgcgcgtcgtgttgcttcatggcgaggggcggtttttctcagcc
ggcgccgatattaaagaattcacgtccatcgcttccgtcgaggaggcatccggcttgtcg
cgcaacggccaactcgtgatggagcggatcgaacgcttttccaaaccagtcattgcggcg
attcacggcgccgcattaggcggtgggttggagctggctatgagctgccacattcgtgtg
gtggcggaaaacgccaaactcggccttccggagctgcagcttggcatcatccctggattt
gctggcacgcagcggcttgtgcgctacgtcggctttggcaaagcggcggaaatgatgtgg
acgagcgagccgatcaccggactcgaagcggttgaatgggggcttgccaacaaggcggtg
ccggaagagcggcttcttgatgaagcaaaagcgttggcgaaaaagattgccgccaaaagt
ccgctttccgtccgtgcgacgattgaactgctcaacgccgcgaaggaaaaatcgtttgcc
gaggcagtgcgcgaggaagcggaatggtttggccgcgtgtttgtatccgaggatgcaaaa
gaaggcgtgcaggcatttttggaaaaacggccgcctgtctttaaagggaaatga

DBGET integrated database retrieval system