KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_30390Help
Entry
GTCCBUS3UF5_30390 CDS       T01676                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gte  Geobacillus thermoleovorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GTCCBUS3UF5_30390
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    GTCCBUS3UF5_30390
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GTCCBUS3UF5_30390
Enzymes [BR:gte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GTCCBUS3UF5_30390
Exosome [BR:gte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GTCCBUS3UF5_30390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2793690..2794970
Genome map
AA seq 426 aa AA seqDB search
MFQSKRRTALLIAVLSAGLALHQAGQDAWAAPAKQSKPSEVKNVVLFVGDGMGTAHRNAI
RLATKGIAGELEMDDMPYSGLVHTNSADSKSFITDSAAAATAIASGVKTYNGAISVDLQG
KPVETILEQAKKAGKATGLVTTAQVTDATPAAFAAHTANRSAQSDIAKQYIEQTKVDVIL
GGGEDYWYPAGNPGYYPDHPAEDPEEASKGTQGNLVERAKQLGYTYVRTADELKQASGRK
LLGLFANEEMFQQRPEGEGDVYNPVVPLPDMTKKALDVLSQNKKGFFLVVEEEAIDEMSH
ENNGSLMIKAGQQLDEAVAVAKQYAKRHRDTLVLVLADHECGGLTIETPGGTDESGDGKT
ISGEDGPFPIARSTQTFALDWTTTGHTAADVPLTAMGPGAERFTGIYENTRIHDILEQLL
FGKSRR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttccaatcgaaacgccgcacggctttgctcatcgccgtgctgagcgccggactggcg
ctgcatcaagccggacaagatgcatgggccgccccagcgaaacaatcgaagccgtctgag
gtgaaaaatgtcgtcctttttgtcggcgacggcatgggcacagcgcatcgcaacgccatt
cgccttgccacaaaagggatcgctggagaattggagatggacgatatgccatacagcggg
cttgtccatacgaactccgccgactcgaagtcattcatcaccgactccgctgcggcggcg
accgcgatcgcctcaggcgtgaaaacgtacaacggcgccatctctgttgatctgcaagga
aaaccagtggaaacgattttggaacaagcaaaaaaagccggcaaggcaacagggcttgtc
acgaccgcccaagtgacggacgccacgccggctgcgtttgccgcccacaccgccaatcgc
tctgcccaaagcgacatcgccaagcaatacatcgaacaaacgaaagtggatgtcattttg
ggcggcggggaagattactggtatcctgctggaaatcctggctattaccccgaccatcca
gccgaagatccggaagaagcaagcaaaggcacgcaaggaaacttggttgaacgcgccaag
cagctcggctacacgtacgtccgcaccgccgatgagctgaaacaagcgtccggccgcaag
ctgcttggactgtttgccaacgaagaaatgttccagcagcgccccgaaggagaaggagat
gtgtacaatcccgttgtgccgctgcccgatatgacaaaaaaagcgcttgacgtgctgtcg
caaaataaaaagggctttttcctcgttgtcgaagaagaagccattgatgaaatgagccat
gaaaacaacggatcgctcatgatcaaagcgggccagcagcttgacgaagcggtcgccgta
gcgaaacagtacgccaagcgccatcgggatacgctcgtcctcgtgctcgctgaccatgaa
tgcggcggcttgacgatcgaaacgccgggcggcacggatgagtcgggagacggcaaaacg
atctccggcgaagacggtccgtttccaattgcccgctctacgcaaacgttcgccctcgac
tggacgacaacaggccacaccgccgccgatgtgccgctgactgccatgggcccgggagcg
gagcgattcaccggcatttatgaaaatacgcgcattcatgacattctcgaacaattattg
tttggaaaaagcagaagataa

DBGET integrated database retrieval system