KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_30560Help
Entry
GTCCBUS3UF5_30560 CDS       T01676                                 

Definition
(GenBank) aminopeptidase ysdC
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AEV20358
UniProt: G8N4U8
Position
complement(2807136..2808224)
Genome map
AA seq 362 aa AA seqDB search
MAKLDETLTMLKALTDAKGVPGNEREARDVMKTYIAPYADEVTTDGLGSLIAKKEGKSGG
PKVMIAGHLDEVGFMVTQIDDKGFIRFQTLGGWWSQVMLAQRVTIVTKKGDITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDMIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKGVDHPNTVYGVGTVQEEVGLRGARTAAQFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLREFVIEVAEELNIPYHFDAMPGGGT
DAGAIHLTGIGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDADKVKQLTF
DE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttggacgaaacgttgacgatgctgaaagcgctgaccgatgcgaaaggcgtc
ccgggcaatgagcgggaagcgcgcgatgtgatgaagacatacatagctccgtatgcggat
gaagtgacaacggatggcctcggcagcttgatcgccaaaaaagaagggaaatcgggcggg
ccgaaagtgatgatcgccggccatttggatgaagtcggctttatggtgacgcaaatcgac
gacaaaggattcatccgcttccaaacgctcggcggctggtggagccaagtgatgctcgcc
cagcgcgtgacgatcgtgacgaaaaaaggcgacatcaccggcgtcatcggttcgaagccg
ccgcacattctgccgccggaggcgcgcaaaaaaccggtggaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagcgatggagtggggcgtccgcccgggcgatatg
atcgtgccgtattttgaatttacggtattgaacaatgaaaaaatgctgctcgcgaaagca
tgggacaaccggatcggctgtgcggtcgccatcgatgtgctcaagcagctgaaaggcgtc
gaccatccaaacacggtatacggcgtcggcacggtgcaggaagaagtcggcttgcgcggc
gcgcgcacggccgcccaattcattcagccagatatcgcgtttgctgttgacgtcggcatt
gccggcgacacgccgggggtgtcggaaaaagaagcgatgggcaaactcggcgccggcccg
cacatcgtcttgtacgacgcaacgatggtgtcgcaccgcggcttgcgcgaatttgtcatc
gaagtggcggaagagctcaacattccgtaccattttgatgccatgccaggcggcggtacg
gacgcgggagcgattcacttaaccggcatcggcgttccgtcgctcacgattgccatcccg
acgcgctacatccactcgcacgccgccattttgcaccgcgacgactacgaaaacacggtc
aagctgcttgttgaggtgatcaaacggcttgacgccgacaaagtgaaacaactgacgttt
gacgaataa

DBGET integrated database retrieval system