KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_31850Help
Entry
GTCCBUS3UF5_31850 CDS       T01676                                 

Definition
Dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
gte  Geobacillus thermoleovorans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTCCBUS3UF5_31850
  Amino acid metabolism
   00300 Lysine biosynthesis
    GTCCBUS3UF5_31850
Enzymes [BR:gte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     GTCCBUS3UF5_31850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2934379..2935794)
Genome map
AA seq 471 aa AA seqDB search
MALNIDWMNEAKKRKDDLVRDVQALVRIPSVREDQQAQPGAPFGPKVAQALEHMLRRGRE
EGFRVKNVDGFAGHIEMGHGEKLVGVLGHIDVVPPGDGWTMDPFAAEVRDGRLYGRGAID
DKGPTVAAFYAMKIIRELGLPLGKRVRLIIGGDEESDWRCVEHYFRHEEMPDVGFAPDAD
FPIIYAEKGIIDADLSYRPPKSAEAEGLALASFQAGRRYNMVPDAAEAVVERAGRTEELL
GLYEQFCWERGVKGSMRQSEGAVVFQLEGVSAHGAEPERGKNAGVYLAQFLASLPLDGRS
RPFVQFVASAFFGDARGRRLGLAYRDEQSGDLTVNVGVLSYDRRHGGTIGLNIRYPVTAD
GDAIRRTLAGAAAEHGFALSRFSDTKPHYIDPSHELVRTLQRVYEEQTGEPARLLAIGGG
TYARALTAGVAFGALFPGRPDVAHQKDEYIEIDDLVKATAIYAQAIYELAK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaacatcgactggatgaacgaagcgaagaaacgaaaagacgatcttgtccgc
gacgtgcaagcgcttgtccgcattccgagcgtccgcgaggatcagcaggcgcaaccaggc
gcgccgtttgggcccaaggtggcccaggcgcttgagcatatgcttcgccgcggccgggag
gaagggtttcgcgtcaaaaatgtggacggatttgctgggcatatcgaaatggggcatggg
gagaaacttgtcggcgtgctcggccatatcgacgtcgtgccgcccggggacggctggacg
atggatccgtttgccgctgaggtgcgcgatggccgcctttacgggcgcggcgcgatcgat
gacaaagggccgaccgtcgcggcgttttacgcgatgaaaatcatccgtgaactcgggctg
ccgcttggcaagcgggtgcggctcatcatcgggggcgatgaggaaagcgactggcggtgt
gtggagcattattttcgccatgaggaaatgccggatgtcggatttgcgccggatgctgat
ttcccgatcatttatgctgaaaaaggaatcattgacgccgatttgtcgtaccgcccgcct
aaatcggcggaggcggaagggctcgcgcttgcctcattccaagccgggcgccgctacaat
atggtgccggatgcggccgaagcggtggtggaaagagcgggacggacggaggagctgctt
ggcctctatgaacagttttgctgggagcgcggcgtaaaggggagcatgaggcaaagcgaa
ggggccgtcgtctttcaattggaaggggtgtccgctcatggcgccgagccggagcgcggc
aaaaacgccggcgtctatttggctcagtttttggcgtcgcttccgctcgatggccgaagc
cggccgttcgttcagtttgtggcctccgccttttttggcgatgcccgcggccggcggctc
ggccttgcgtatcgggacgaacaaagcggcgacttgacggtcaacgtcggggtgctgtcg
tatgaccggcggcatggcggaacgattgggctgaacatccgctatccggtgacggccgac
ggtgacgcgatccgccggacgctcgccggcgctgcggctgaacatggattcgcgctcagc
cgtttcagcgatacgaagcctcattatatcgatccgagccacgagcttgtccgcacgctt
cagcgcgtctacgaagagcagacgggcgagccggcccggcttttggccatcggcggcggc
acatacgcccgcgccttgaccgccggggtggcgtttggcgcgttgtttccgggccgtccg
gatgtcgcccaccagaaagatgagtatatcgaaatcgacgatttggtgaaagcgacagcc
atttacgcgcaggcgatctacgagctggcgaaataa

DBGET integrated database retrieval system