KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_32440Help
Entry
GTCCBUS3UF5_32440 CDS       T01676                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gte  Geobacillus thermoleovorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GTCCBUS3UF5_32440
Enzymes [BR:gte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     GTCCBUS3UF5_32440
Exosome [BR:gte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GTCCBUS3UF5_32440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2988679..2990679)
Genome map
AA seq 666 aa AA seqDB search
MIAANPTDLEVYLFHEGRLYQSYELFGAHVIRGGGAVGTRFCVWAPHAREVRLVGSFNDW
NGANSSLTKVNDEGVWTIVVPENLEGHLYKYEIITPDGRVLLKADPYAFYSELRPHTASI
VYDLKGYEWNDSSWQRKKRRKRIYDQPMVIYELHFGSWKKKPDGRFYTYREMADELIPYV
LERGFTHIELLPLVEHPLDRSWGYQGTGYYSVTSRYGTPHDFMYFVDRCHQAGLGVIIDW
VPGHFCKDAHGLYMFDGAPTYEYANEKDRENYVWGTANFDLGKPEVRSFLISNALFWLEY
YHVDGFRVDAVANMLYWPNNDRLYENPYAVEFLRQLNEAVFAYDPNVWMIAEDSTDWPRV
TAPTYDGGLGFNYKWNMGWMNDMLKYMETPPHERKYAHNQVSFSLLYAYSENFILPFSHD
EVVHGKKSLLNKMPGSYEEKFAQLRLLYGYMMAHPGKKLLFMGSEFAQFDEWKFAEELDW
VLFDFELHRKMDEYVKQLIACYKRYKPFYELDHDPRGFEWIDVHNAEQSIFSFIRRGKKE
GDVLVIVCNFTNQAYDDYKVGVPLLAPYREVLNSDAAEFGGSGHVNGKRLPAFSEPFHGK
PYHVRMTIPPFGISILRPVQKRGERKQNEEEVHRHVIGRRARKPASLADEKHRETSRAVW
GEVPDH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
ttgattgcggcgaatccgacagatttagaagtgtatttgtttcatgaaggccgtttgtat
caaagttatgagctgttcggcgctcatgtcatccgcggcggcggagcggtcggcactcgc
ttttgcgtgtgggcgccccatgcgcgggaagtccgtcttgtcggcagtttcaacgattgg
aatggggcgaattcctccctgacgaaggtgaacgacgaaggggtatggacgatcgttgtt
ccagaaaacttggaagggcatctctataaatatgagatcatcacaccggatggccgtgtt
ctgttgaaagccgacccgtacgccttttactccgaattgcgccctcataccgcctcgatt
gtctacgatttgaaaggatacgagtggaatgattcatcttggcagcggaagaaacggcga
aagcggatttatgaccaaccgatggtcatttatgaacttcatttcggttcgtggaaaaag
aaaccggacggccgcttttatacgtaccgtgagatggccgacgaactcattccgtacgtg
ctggagcgcggatttacgcacattgagctgcttccgcttgtcgagcatccgctcgatcgt
tcgtggggatatcaagggaccggctattattcggtgacaagccgctatggcacgccgcac
gatttcatgtatttcgtcgaccgctgccatcaagcggggcttggcgtcatcatcgactgg
gtgccggggcatttttgcaaggacgcccacgggctgtacatgtttgacggcgcgccgacg
tatgaatacgcgaatgaaaaagaccgagaaaattacgtctgggggacggcgaattttgac
ttgggcaagccggaagtgcgcagttttctgatctccaatgcgttgttttggctggagtat
taccatgtggacgggtttcgcgtcgatgcggtcgccaatatgctttattggccgaacaac
gaccggctctatgaaaatccgtatgcggtcgagtttttgcgccagttgaatgaggcggtg
tttgcctatgacccgaacgtctggatgatcgctgaagattcgaccgactggcctcgggtg
accgcgccgacgtacgatggcggccttgggtttaactacaagtggaacatgggctggatg
aacgacatgctgaagtatatggaaacgccgccgcatgagcggaaatacgcccataaccaa
gtcagtttttccctcctttatgcgtattcggaaaatttcattttgccattttcccatgat
gaagttgtgcatggcaaaaaatcgctgctcaataaaatgcctgggtcgtacgaagagaag
ttcgcccagctgcgcctattgtatgggtacatgatggcccaccctgggaaaaagctgctg
tttatgggcagtgagtttgcccagtttgatgaatggaagtttgccgaggagctggactgg
gtgctgttcgattttgaattgcaccggaaaatggacgaatatgtgaagcagctgatcgcc
tgctataaacggtataagccgttttacgagcttgatcatgatccgagagggtttgaatgg
attgacgttcataatgccgagcaaagcattttttcattcatccgccgggggaaaaaagaa
ggtgatgtgctggtcattgtttgtaatttcacaaatcaggcgtatgacgattacaaagtc
ggcgtgccgcttttggcgccgtaccgcgaagtgcttaacagcgatgcagcggagtttggc
ggttcgggacatgtcaacgggaagcggcttcccgctttcagtgagccgtttcatggaaaa
ccgtaccatgtgcgcatgacgattccgccgtttggcatttccattttgcggccagtgcaa
aaacgaggggagagaaagcagaatgaagaagaagtgcatcgccatgttattggccggcgg
gcaaggaagccggcttcgctcgctgacgaaaaacatcgcgaaaccagccgtgccgtttgg
ggggaagtaccggatcattga

DBGET integrated database retrieval system