KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_33010Help
Entry
GTCCBUS3UF5_33010 CDS       T01676                                 

Definition
cytosol aminopeptidase
Orthology
K01255  
leucyl aminopeptidase [EC:3.4.11.1]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GTCCBUS3UF5_33010
Enzymes [BR:gte01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     GTCCBUS3UF5_33010
Peptidases [BR:gte01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   GTCCBUS3UF5_33010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3038328..3039311)
Genome map
AA seq 327 aa AA seqDB search
MERDETMFTVKPLPSVEERDEALVVGLFEGANSWSGLAGEYDARLGGRLSELQKEGDISA
KRGRIATVHPFLPMGAKRLYFVGLGKKEELTFERLREVFGKLFRALKQAKRTKAAVALDT
FTTEAVDGNEAAHALAEAYHLATYEFPGYKQKKSQSDYQLESLIVYTAAEAAEIEASLFV
GSVYGKATNSARTLVNTPGNLLTASDLADYAVKLANRYDFDYEVLEKEDMERLGMGALLA
VNQGSKQPPKLIILKYQGKDEWEDVIALVGKGVTFDTGGYCLKPRDSMVDMKTDIWPARR
RCSGRWKRSANCGRNKTCSPSFRRPTI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaaagggatgagacgatgtttacggtaaaacctttgccgtcggtggaggaacgggat
gaagcgcttgtcgtcggtttgtttgaaggggcgaattcatggagcggccttgccggcgaa
tacgatgcccgtcttggcggacggctgtcggaactgcagaaagaaggcgatatttccgcg
aaacgggggcgcatcgccaccgttcatccatttttgccgatgggggcgaagcggctgtat
ttcgtcggtctcggcaaaaaagaagagttgacgtttgagcggctgcgcgaggtgttcggc
aagctgtttcgcgcgttgaagcaggcgaagcggacgaaagcggcggtcgcgctggacacg
tttacgaccgaggccgtcgatggaaacgaagcggcgcatgccttggcggaagcctatcat
ttggcgacgtatgaattccctgggtataagcagaaaaagtcacaatcggactaccagctc
gaatcgctcatcgtctacacggcggccgaagcggcggaaattgaagcgagcttgtttgtc
ggctcggtatacgggaaggcgacgaattcggcgcgcacgcttgtcaatacgccggggaat
ttgctgacggcgtcggatttggctgattatgccgtgaagctcgcgaaccgatacgatttt
gactatgaagttttggagaaagaagacatggagcggctcggcatgggagcgcttttggcc
gtcaatcaaggctcgaaacagccgcccaaactgatcatcttaaaataccaaggaaaagac
gagtgggaagacgtgatcgccctcgtcggcaaaggggtgacgttcgatacgggcggctat
tgtttgaagccgcgcgacagcatggtcgacatgaaaaccgatatatggccggcgcggcgg
cggtgctcggggcgatggaagcgatcggcgaactgcggccggaacaaaacgtgctcgccg
tcattccggcgaccgacaatatga

DBGET integrated database retrieval system