KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_34130Help
Entry
GTCCBUS3UF5_34130 CDS       T01676                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gte  Geobacillus thermoleovorans
Brite
Enzymes [BR:gte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GTCCBUS3UF5_34130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3134992..3135735)
Genome map
AA seq 247 aa AA seqDB search
MMKIVPPKPFFFEAGERAVLLLHGFTGNSADVRMLGRFLESKGYTCHAPIYKGHGVPPEE
LVHTGPDDWWQDVMNGYQFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPTQGIVTMCAPMY
IKSEETMYEGVLEYAREYKKREGKSEEQIEQEMERFKQTPMKTLKALQELIADVRAHLDL
VYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIKWYEQSGHVITLDQEKDQLHEDIYA
FLESLDW
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaattgttccgccgaagccgtttttctttgaagccggggagcgggcggtgctg
cttttgcatgggtttaccggcaattccgccgacgttcggatgcttgggcgattcttggaa
tcgaaagggtatacgtgccacgctccgatttacaaagggcatggcgtgccgccggaagag
cttgtccacaccggaccggatgattggtggcaagacgtcatgaacggctatcagtttttg
aaaaacaaaggctacgaaaaaattgccgtggctggattgtcgcttggaggcgtattttct
ctcaaattaggctacactgtacctacacaaggcattgtgacgatgtgcgcgccgatgtac
atcaaaagcgaagaaacgatgtacgaaggtgtgctcgagtatgcgcgcgagtataaaaag
cgggaagggaaatcagaggaacaaatcgaacaggaaatggaacggttcaaacaaacgccg
atgaagacgttgaaagccttgcaagaactcattgccgatgtgcgcgcccaccttgatttg
gtttatgcaccgacgttcgtcgtccaagcgcgccatgatgagatgatcaatccagacagc
gcgaacatcatttataacgaaattgaatcgccggtcaaacaaatcaaatggtatgagcaa
tcaggccatgtgattacgcttgatcaagaaaaagatcagctgcatgaagatatttatgca
tttcttgaatcgttagattggtaa

DBGET integrated database retrieval system