KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_34220Help
Entry
GTCCBUS3UF5_34220 CDS       T01676                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTCCBUS3UF5_34220
   01230 Biosynthesis of amino acids
    GTCCBUS3UF5_34220
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_34220
   00051 Fructose and mannose metabolism
    GTCCBUS3UF5_34220
   00562 Inositol phosphate metabolism
    GTCCBUS3UF5_34220
Enzymes [BR:gte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GTCCBUS3UF5_34220
Exosome [BR:gte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GTCCBUS3UF5_34220
  Exosomal proteins of bladder cancer cells
   GTCCBUS3UF5_34220
  Exosomal proteins of melanoma cells
   GTCCBUS3UF5_34220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3144353..3145114)
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLAEAVQFVENVKGHVPPADEVDSVVCAPFLFLDRLVQAADGTDLK
IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG
LIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTP
EDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQEQIDGALVGGASLEP
ASFLQLVEAGRHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgcatcattgcaggcaactggaaaatgcataaaacattggcggaagccgtt
caatttgtcgagaacgtaaaagggcacgtgccgccggccgacgaagtcgattccgtcgtt
tgcgcgccgtttctctttttggatcggttggtgcaagcggcagacggcacggatttaaaa
atcggggcgcaaacgatgcactttgccgatcaaggggcgtacacaggcgaagtgagcccg
gtcatgctgaaagacctcggcgtcacgtacgtcatcctcggccattcggagcgccggcaa
atgttcgccgaaacagatgagaccgtgaacaaaaaagtgttggccgccttcacccgcggg
cttataccgattatttgctgcggcgaatcgcttgaggagcgggaagcggggcagacgaac
gccgttgtcgcctcgcaagtggaaaaagcgctcgccggcttgacgccggaacaagtgaag
caagcggtcatcgcttacgagccgatttgggcgatcgggacgggcaaatcatcaacaccg
gaagacgccaacagcgtctgcggccatatccgttcggttgtttcgcgcctgtttggcccg
gaggcggcggaagcgatccgcatccaatacggcggcagcgtcaaaccggacaacatccgc
gacttcttggcgcaagaacagatcgacggcgccttagtcggcggggcgagcctcgagccg
gcttcattcttgcaattggtggaggcgggccgccatgagtaa

DBGET integrated database retrieval system