KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_34470Help
Entry
GTCCBUS3UF5_34470 CDS       T01676                                 

Definition
Histidinol dehydrogenase 2
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gte  Geobacillus thermoleovorans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GTCCBUS3UF5_34470
  Amino acid metabolism
   00340 Histidine metabolism
    GTCCBUS3UF5_34470
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GTCCBUS3UF5_34470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3164480..3165754)
Genome map
AA seq 424 aa AA seqDB search
MKIERIRGGVSLRRTIESGTEEQRRAVLDIIANVRDRGDAALKEYTERFDGVKLDSLKVT
EEEMKRAHAAMDAEMLEIIRQAAANIRDYHKRQKRESWWMTKEDGTILGQKVTPLDAVGL
YVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKDGTLPAGVLAAAYELGVTEIYKVG
GAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGHVAIDMIAGPSEIVVLADETAR
PDEIAADLLSQAEHDVRASAILVTPSMKLALAVASEVERQLETLPRRDIAQAALENYGAI
YVTETLEEAVDVVNELAPEHLEVMTAEPLSLFGRLRHAGAMFFGRFSSEPVGDYFAGPNH
VLPTNGTARFSSGLSVDEFVKKSSVIVYSETALKQHGDKIAAFARLEGLEAHARAIEVRL
EKGE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgaacggatccgaggcggcgtctcgctgcggcgcacgattgaaagcggaacg
gaggagcagcggcgcgcggtgcttgatatcatcgccaatgtgcgcgaccgcggcgatgcg
gcgctgaaagaatatacggaacggtttgacggcgtcaagctggattcgctcaaggtgacg
gaagaggaaatgaagcgcgcgcatgcggcgatggacgcggagatgctggagatcattcgc
caagcggcggccaacattcgcgactaccacaaacggcaaaagcgcgaatcatggtggatg
acgaaagaagacggcacgattctcggacaaaaggtgacgccgctcgatgcggtcgggttg
tacgtgccaggcgggacggccgcttatccgtcgtctgtgctgatgaacgttattcccgca
caagtggcgggggtgaaacggattgtcatcacctcgccgccaaacaaagacggcacgctc
ccggctggggtgctggccgccgcctatgaactcggcgtgacggaaatttacaaagtcggc
ggcgcgcaggcgatcgccgcgcttgcttatgggacggaaacgatccggccggttgacaaa
attttcgggccgggcaatatttatgtggcattggcgaagcgggaagtgttcgggcatgtg
gcgatcgacatgatcgcggggccgagcgaaattgtcgtgctggcggatgaaacggcccga
ccggatgagattgcggcggatttgttgtcgcaagccgagcatgacgtgcgggcgtcggcc
attttggtgacgccgtcgatgaaattggcgctggcggtggcgagcgaagtcgaacggcag
ctggaaacgctgccgcgccgcgacattgcccaagcggcgctcgagaactacggcgccatt
tacgtcaccgagacgcttgaggaagcggtggatgtcgtgaacgaactggcgccggagcat
ttggaagtgatgacggcagaaccgctctcgcttttcggccggctccgccatgcgggagcg
atgtttttcggccgcttcagctccgagccggtcggcgactatttcgccgggccgaaccac
gtgctgccaaccaacggcacggccagattctcaagcggcttgagcgttgacgagtttgtg
aaaaaatcaagcgtgattgtttacagtgaaaccgcattgaaacaacatggcgacaaaatc
gccgcctttgcccgcctcgaggggctggaggcgcacgcgcgcgccattgaggtgcggctc
gagaaaggggaatga

DBGET integrated database retrieval system