KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_36800Help
Entry
GTCCBUS3UF5_36800 CDS       T01676                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase 2
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00040  Pentose and glucuronate interconversions
gte00052  Galactose metabolism
gte00500  Starch and sucrose metabolism
gte00520  Amino sugar and nucleotide sugar metabolism
gte01100  Metabolic pathways
gte01130  Biosynthesis of antibiotics
Module
gte_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GTCCBUS3UF5_36800
   00052 Galactose metabolism
    GTCCBUS3UF5_36800
   00500 Starch and sucrose metabolism
    GTCCBUS3UF5_36800
   00520 Amino sugar and nucleotide sugar metabolism
    GTCCBUS3UF5_36800
Enzymes [BR:gte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GTCCBUS3UF5_36800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: AEV20980
UniProt: G8MZ35
Position
complement(3386834..3387721)
Genome map
AA seq 295 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKG
KRAIEDHFDYAFELEQMLKQKGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAEKPCLKQLIEQYEQTFSSVIGVKRVPEEETHRYGIIDPLEQQGR
RYQVRRFVEKPAPGTAPSNLAIVGRYVLTPEIFLFLEKQEAGAGGEIQLTDAIGRLNEIQ
RVFAYEFEGKRYDVGEKLGFIETTIEFALQNEELRDDLLSFLERVVAEAKGSKNN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgcaaagcgatcattccggcggccgggcttgggacgcggtttctgccg
gcgacgaaggcaatgccgaaggagatgcttccgatcgttgataagccgacgattcaatat
attgtcgaagaagccatcgcctcaggcattgaggacattattatcgtcaccgggaaaggg
aagcgggcgattgaggatcattttgactacgcgtttgagctggaacagatgctcaagcaa
aaagggaagctggatctgcttgagaaagtgaaagagccgtcgaaggtggacatccactac
attcgccaaaaagagccgaaagggctcgggcatgcggtttggtgcgcgcgcaatttcatt
ggagacgagccgtttgcggtgttgttgggcgatgatatcgtccaggcggaaaagccttgt
ttaaaacagctcattgagcagtatgaacaaacgttcagctcggtgattggtgtcaagcgc
gtgccggaggaagaaacgcatcgctacgggatcatcgacccgctcgagcagcaaggccgg
cgctaccaagtgcgccgcttcgtggaaaaaccagctccgggcacagcgccgtcgaacttg
gcgatcgtcggccgctacgtgttgacgccggaaattttcttgtttttagagaaacaggaa
gccggcgcaggcggggagattcagctcaccgatgcgatcgggcggttgaatgaaattcag
cgcgtgtttgcctatgaatttgaaggaaagcggtacgatgtcggcgaaaagctcggcttt
atcgaaacgacgattgagtttgccttgcaaaacgaggagctgcgggatgacttgctttcg
tttttggagcgggtggtggcagaggcgaagggatcgaagaacaactaa

DBGET integrated database retrieval system