KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_4640Help
Entry
GTCCBUS3UF5_4640  CDS       T01676                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00010  Glycolysis / Gluconeogenesis
gte00030  Pentose phosphate pathway
gte00051  Fructose and mannose metabolism
gte00052  Galactose metabolism
gte00230  Purine metabolism
gte00500  Starch and sucrose metabolism
gte00520  Amino sugar and nucleotide sugar metabolism
gte00521  Streptomycin biosynthesis
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
gte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_4640
   00030 Pentose phosphate pathway
    GTCCBUS3UF5_4640
   00051 Fructose and mannose metabolism
    GTCCBUS3UF5_4640
   00052 Galactose metabolism
    GTCCBUS3UF5_4640
   00500 Starch and sucrose metabolism
    GTCCBUS3UF5_4640
   00520 Amino sugar and nucleotide sugar metabolism
    GTCCBUS3UF5_4640
  Nucleotide metabolism
   00230 Purine metabolism
    GTCCBUS3UF5_4640
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GTCCBUS3UF5_4640
Enzymes [BR:gte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GTCCBUS3UF5_4640
    5.4.2.8  phosphomannomutase
     GTCCBUS3UF5_4640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: AEV17788
UniProt: G8N4B3
Position
449076..450443
Genome map
AA seq 455 aa AA seqDB search
MFKEYDIRGRAGEELDESFAYWLGRAFADMMQKEGEKRAVVGHDNRLSSPGLHRALKDGL
LDGGCDVVDIGLSTTPMFYYSLYYTNIPCGMIITASHNPGDENGFKIAMGKTTIYGERIQ
ALRRAMERLSQEQPRPETARGREETLDLAPAYIKMLKEKIQLGPRKLKVVVDCGNGTPSI
IAPQVLKEWGCDVVPLYCESDPTFPNHHPDPVVPENLTALIEMVRKEQADLGIAFDGDGD
RIGVVDETGAIRWGDQLMVLFWREILKRYPGADAPVEVKCSQALVEEIERLGGKPFFHRT
GHSHVKATLRRRPEIPFAGEMSGHLFFNDEFYGYDDALYAAGRLLRLLSHDERPLSEWFA
DVPRYAATPETRVACPEEKKPAAIAAVKNRFAGRYPVVDVDGARIQFPEGWGLVRPSNTQ
PILVLRAEAKTEEALAEIKRQLADCLHALELCIDW
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaagaatacgacatccgcggacgagccggagaggagctcgatgagtcgttcgcg
tattggctcggacgggcctttgccgacatgatgcaaaaggaaggcgagaagagggcggtt
gtcggtcatgacaatcgtctatcatcgcctggcttgcatcgggcgctcaaagatgggctg
ctcgatggcggctgcgatgtcgtcgatattgggctttcgacgacgccgatgttttactac
agcttatactacacgaacattccatgcggcatgatcatcaccgccagccataacccaggg
gatgagaacggatttaaaatcgccatgggaaaaacgacaatttatggcgagcgcatccaa
gcgttgcggcgggcgatggagcggctcagccaggaacagccgcggcctgaaacagcgcgc
gggcgcgaggaaacgttggaccttgctccggcatatatcaagatgttgaaggagaaaatc
caactcggtccgcgcaagctgaaggtcgtcgtcgactgcggcaacggcaccccatcgatc
attgcgccacaagtgctcaaagagtggggatgcgatgtcgtcccgctttactgtgaatcc
gatccaacgtttccgaaccatcatccggacccggtcgtgccggagaacttaacggccttg
attgagatggtgcgcaaggagcaggctgatcttggcatcgcgtttgacggcgacggtgat
cggatcggggttgtggatgaaacgggtgcgatccgttggggcgaccaactgatggtgctg
ttctggcgcgagattcttaagcgctatccgggagccgacgcgcccgttgaagtgaaatgt
tcgcaagcgcttgttgaggaaattgagcggctcggcgggaaaccgttcttccatcgcacc
ggccattcgcacgtcaaagcgacgttgcgccgtcgtccggagatcccgtttgctggtgaa
atgtctggccatttgttcttcaatgatgagttttacggctatgacgatgcactgtacgcc
gctgggcgcctgcttcgattactgtcgcacgatgagcgcccgctgtccgagtggtttgcc
gatgtgccgcggtacgcggcgacgccggagacgcgagttgcttgtccggaagagaaaaaa
ccagctgccattgctgcggtgaaaaaccggttcgctggccgctatccggttgttgacgtc
gatggcgcccgcatccagttcccggaaggctgggggttggtgcggccgtcgaacacgcag
ccgattctcgtcttacgcgcagaagcgaagacggaggaagcgctggcggagattaagcgg
caactggctgattgtctccatgctcttgaattgtgcatcgattggtga

DBGET integrated database retrieval system