KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_470Help
Entry
GTCCBUS3UF5_470   CDS       T01676                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
gte  Geobacillus thermoleovorans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GTCCBUS3UF5_470
Enzymes [BR:gte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     GTCCBUS3UF5_470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
53415..54206
Genome map
AA seq 263 aa AA seqDB search
MKMVMTTIDLADRIELVALPEEDAIRIVSQNRFVPDDCRNLAYQAAKLLKETFSIRQGVA
ISITKHIPVAAGLAGGSSDAAATLRGLNKLWQLGLTMDELAELGAKIGSDVAFCVYGGTA
LATGRGEIITPIASPPPCWVVLAKPPIGVSTAEVYRNLELERVSHPDVDAMVRAIERQDY
AAICRLVGNVLEEVTLKKYPEVAHIKEQMKRFGADAVLMSGSGPTVFGLIEHDSRMQRVY
NGLRGFCDQVFAVRMLGERHSLD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatggtgatgacgacgatcgatttggccgatcgcattgagcttgtcgcgttgccg
gaggaagatgcgatccgcatcgtttcgcaaaaccgctttgtgccggatgattgccgcaac
ttggcgtatcaggcggctaagcttcttaaagagacgttttcgatccgccaaggggtggcc
atttcgattacgaagcatattccggtggccgccggattggcgggaggaagcagcgatgcg
gcggcgacgctgcgtgggttgaacaagctttggcaacttggattaacgatggatgaactg
gcagagctcggggcgaaaatcggatcagatgtcgctttttgcgtctacggcggaaccgcc
ttggcgacggggcgcggggaaatcatcactccgatcgcttcgccgccgccgtgctgggtt
gtgctggccaagcccccgatcggtgtatcgacggcggaagtgtaccgaaacttggaactt
gagcgtgtcagccatccagacgtcgatgcgatggtgagagcgatcgagcggcaagattat
gcggcgatctgccggttggtcggcaatgttcttgaggaagtgacgttgaaaaaatatccg
gaagtcgcgcatattaaagaacaaatgaagcggtttggcgctgatgcggtgctgatgagc
ggcagcgggccgaccgtgtttggactgatcgagcacgattcgagaatgcagcgggtatac
aatgggttgcgcggcttttgtgaccaagtgtttgcggtgagaatgttaggagaacgacat
tctcttgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system