KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_7330Help
Entry
GTCCBUS3UF5_7330  CDS       T01676                                 

Definition
(GenBank) Protoporphyrinogen oxidase
  KO
K00231  
protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GTCCBUS3UF5_7330
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GTCCBUS3UF5_7330
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     GTCCBUS3UF5_7330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
693569..695008
Genome map
AA seq 479 aa AA seqDB search
MNEGQRTVVIIGGGITGLTAAYYLQKAIREQRLPLACKLVEATHRLGGKVQTVVRDGFVI
ERGPDSFLARKTSAFRLVKEVGLEHEIVHNATGTSYILVNGKLYPIPGGAVMGIPTRIAP
FLTTGLFSPAGKLRAALDFVLPPVKVDGDMPLGRFFRRRLGDEVVDNLIEPLLSGIYAGD
IDEMSLMATFPQFFQLEQKYGSLVRGARRTTPKEQKERKGAFQTLKTGLQSLVDEVEKRL
EPGSVIKGVRVERIVRTDSAYRLQLSTGEVWGADGIIVTTPHHVVPDMFADYPFFAPFRS
VPLTSVATVALAFPEEAIRQDIDGTGFVVSRRSDYTMTACTWTHKKWPHTAPPGKALLRC
YVGRPGDEEIVDQPDDEIVRVVLDDLNKVMNIAGQPEFAVISRWKRAMPQYTVGHRERLA
KIKEQMASELPGVFLAGSSYEGLGLPDCIDQGEKAVRDVLLYLQQAPVQQTSDLYSSVR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagggcaacggacggtcgtcatcatcggcggtggcattaccggcttgacggct
gcttactacttgcaaaaagcgattcgagagcaacgcctcccacttgcatgcaaacttgtc
gaggcgacgcaccggctcggcggaaaagtgcagacggtcgtccgcgacggttttgtcatt
gaacgcggtccagactcgtttttggcgcggaaaacgagcgcgtttcgccttgtgaaggaa
gtcggccttgaacatgagatcgttcataacgcgaccggaacatcgtacattttggtcaac
ggcaaactctatcccattccgggcggagcggtgatgggcattccgacgcgcatcgccccg
tttttaacgaccggactgttttccccggccggcaagctgcgggcggcgcttgactttgtg
ctgccgccggtgaaagtcgatggtgatatgccgcttggccgcttcttccgccgccgcctc
ggcgatgaggtggtggacaatctcatcgaaccgctactttccggcatttacgccggcgac
attgatgagatgagcctaatggcgacgtttccacagttttttcagcttgagcaaaaatac
ggaagccttgtccgtggagcgagacgaacgacgccgaaagagcaaaaagagcggaaaggg
gcgttccagacgttaaaaacgggcttgcagtcgctcgttgatgaagtggaaaaacggctt
gagccgggcagcgtcatcaaaggggtgcgtgtcgagcggatcgttcgcaccgattcggcg
tatcggctgcaactgagcacaggagaggtgtggggggcagacggcatcatcgtgacaacg
ccgcatcatgttgtgcccgacatgttcgctgactatccgtttttcgccccgttccgttca
gtgccgctgacgtcggtggcgacggtggcgctcgcatttccggaggaggcgatccgccaa
gacattgacggcaccgggtttgtcgtttcgcgccgcagcgattacacgatgacagcgtgc
acatggacgcataaaaaatggccgcacaccgcgccgcctggcaaggcgctcttgcgttgc
tacgtcgggcgcccgggcgatgaggagatcgtcgaccaacctgatgatgagatcgtccgt
gttgtattggatgatttaaataaagtgatgaacatcgccggccaaccggagttcgccgtc
atctcgcgctggaagcgggccatgccgcaatacacggtcgggcaccgcgagcggctggcg
aagattaaggagcagatggcgtccgagttgccgggggtgtttttggccggcagctcatac
gaagggctcggattgccggattgcattgaccaaggcgaaaaagcggtgcgtgacgtgctt
ctgtatttgcaacaagcgccagttcaacagacgtccgatctgtacagcagcgtccgttaa

DBGET integrated database retrieval system