KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_7330Help
Entry
GTCCBUS3UF5_7330  CDS       T01676                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
gte  Geobacillus thermoleovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:gte00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693569..695008
Genome map
AA seq 479 aa AA seqDB search
MNEGQRTVVIIGGGITGLTAAYYLQKAIREQRLPLACKLVEATHRLGGKVQTVVRDGFVI
ERGPDSFLARKTSAFRLVKEVGLEHEIVHNATGTSYILVNGKLYPIPGGAVMGIPTRIAP
FLTTGLFSPAGKLRAALDFVLPPVKVDGDMPLGRFFRRRLGDEVVDNLIEPLLSGIYAGD
IDEMSLMATFPQFFQLEQKYGSLVRGARRTTPKEQKERKGAFQTLKTGLQSLVDEVEKRL
EPGSVIKGVRVERIVRTDSAYRLQLSTGEVWGADGIIVTTPHHVVPDMFADYPFFAPFRS
VPLTSVATVALAFPEEAIRQDIDGTGFVVSRRSDYTMTACTWTHKKWPHTAPPGKALLRC
YVGRPGDEEIVDQPDDEIVRVVLDDLNKVMNIAGQPEFAVISRWKRAMPQYTVGHRERLA
KIKEQMASELPGVFLAGSSYEGLGLPDCIDQGEKAVRDVLLYLQQAPVQQTSDLYSSVR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagggcaacggacggtcgtcatcatcggcggtggcattaccggcttgacggct
gcttactacttgcaaaaagcgattcgagagcaacgcctcccacttgcatgcaaacttgtc
gaggcgacgcaccggctcggcggaaaagtgcagacggtcgtccgcgacggttttgtcatt
gaacgcggtccagactcgtttttggcgcggaaaacgagcgcgtttcgccttgtgaaggaa
gtcggccttgaacatgagatcgttcataacgcgaccggaacatcgtacattttggtcaac
ggcaaactctatcccattccgggcggagcggtgatgggcattccgacgcgcatcgccccg
tttttaacgaccggactgttttccccggccggcaagctgcgggcggcgcttgactttgtg
ctgccgccggtgaaagtcgatggtgatatgccgcttggccgcttcttccgccgccgcctc
ggcgatgaggtggtggacaatctcatcgaaccgctactttccggcatttacgccggcgac
attgatgagatgagcctaatggcgacgtttccacagttttttcagcttgagcaaaaatac
ggaagccttgtccgtggagcgagacgaacgacgccgaaagagcaaaaagagcggaaaggg
gcgttccagacgttaaaaacgggcttgcagtcgctcgttgatgaagtggaaaaacggctt
gagccgggcagcgtcatcaaaggggtgcgtgtcgagcggatcgttcgcaccgattcggcg
tatcggctgcaactgagcacaggagaggtgtggggggcagacggcatcatcgtgacaacg
ccgcatcatgttgtgcccgacatgttcgctgactatccgtttttcgccccgttccgttca
gtgccgctgacgtcggtggcgacggtggcgctcgcatttccggaggaggcgatccgccaa
gacattgacggcaccgggtttgtcgtttcgcgccgcagcgattacacgatgacagcgtgc
acatggacgcataaaaaatggccgcacaccgcgccgcctggcaaggcgctcttgcgttgc
tacgtcgggcgcccgggcgatgaggagatcgtcgaccaacctgatgatgagatcgtccgt
gttgtattggatgatttaaataaagtgatgaacatcgccggccaaccggagttcgccgtc
atctcgcgctggaagcgggccatgccgcaatacacggtcgggcaccgcgagcggctggcg
aagattaaggagcagatggcgtccgagttgccgggggtgtttttggccggcagctcatac
gaagggctcggattgccggattgcattgaccaaggcgaaaaagcggtgcgtgacgtgctt
ctgtatttgcaacaagcgccagttcaacagacgtccgatctgtacagcagcgtccgttaa

DBGET integrated database retrieval system