KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_7500Help
Entry
GTCCBUS3UF5_7500  CDS       T01676                                 

Definition
Gex interacting protein 7
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
gte  Geobacillus thermoleovorans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GTCCBUS3UF5_7500
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GTCCBUS3UF5_7500
Enzymes [BR:gte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GTCCBUS3UF5_7500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
705361..706662
Genome map
AA seq 433 aa AA seqDB search
MGEGKMASFAERVRQLEESWKNEERWKGIVRPYSAEDVIKLRGSLDIEYTLARRGAEKLW
KLLHTEDYVAALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPSNSV
PHVVKRINQALQRADQIQYLEGSGDVDYFVPIVADAEAGFGGQLNVFELMKAMIEAGAAG
VHFEDQLSSEKKCGHLGGKVLLPTQTAIRNLIAARLAADVMGVPTVLIARTDANAADLIT
SDIDPRDQAFITGERTPEGFYRTRAGLDQAIARGLAYAPYADLIWCETSEPNLEEARRFA
EAIHEKFPGKLLAYNCSPSFNWKKKLDDETIAKFQQELGKMGYKFQFVTLAGFHALNYSM
FELARGYKERGMAAYAELQQAEFAAEKYGYTATRHQREVGTGYFDEVAQVISGGQSSTVA
LKGSTEEEQFTAI
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaggaaaaatggcgtcatttgctgaacgtgtccggcaattagaagaaagttgg
aaaaatgaggagcgctggaaagggatcgttcgtccgtacagcgctgaggatgtcattaaa
ctgcgcggctcgcttgacatcgagtatacgctcgctcgacgcggggcggaaaaattatgg
aagctgcttcatacagaggattacgtcgcggcccttggcgcgctgaccggaaatcaggcg
gtgcagcaagtgaaagcaggcttgaaggcgatttatttaagcggctggcaagtggcggcc
gacgccaacctcgccggacagatgtatccggaccaaagcctgtatccgtccaacagcgtt
ccgcatgtcgtcaagcgaatcaatcaagcgttgcagcgcgcggatcaaattcaatactta
gaaggcagcggggacgtggactactttgtgccgatcgtcgctgacgctgaggcggggttc
ggaggccaactgaacgtctttgagctcatgaaggcaatgattgaagccggagcggctggc
gtccattttgaagaccagctgtcatcggagaaaaaatgcggccatttaggcggcaaagtg
cttttgccgacgcaaacggcgattcgcaacttgattgcggcgcggttggccgccgatgtc
atgggggttccgacggtgctcatcgcacgcaccgacgcgaacgctgctgacttgatcaca
agcgacatcgacccgcgcgatcaagcgtttatcactggagaacggacaccggaaggcttc
tatcgcacaagagccggtttggatcaagcgatcgcccgtggacttgcctatgcgccgtac
gccgaccttatttggtgcgaaacgagcgaaccgaatttggaagaagcgcgccggtttgcc
gaagcgatccatgagaaattccccggcaagctgctggcgtacaactgctcgccgtcgttc
aactggaagaaaaaattggacgatgaaacgatcgccaaattccagcaagagctcggcaaa
atgggatacaagttccaatttgtcactttggctggcttccatgcgctcaattacagcatg
ttcgaactggcgcgcggctacaaagaacgcggcatggcggcgtacgccgagctgcagcaa
gcggaatttgccgccgagaagtacggatacacggcgacgcgccatcagcgcgaagtcggc
acgggctatttcgacgaagtcgcccaagtgatctccggcggccaatcgtcaacagtcgct
ttgaaaggatcgaccgaagaagaacagtttacagccatctaa

DBGET integrated database retrieval system