KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_7940Help
Entry
GTCCBUS3UF5_7940  CDS       T01676                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00010  Glycolysis / Gluconeogenesis
gte00020  Citrate cycle (TCA cycle)
gte00620  Pyruvate metabolism
gte01100  Metabolic pathways
gte01110  Biosynthesis of secondary metabolites
gte01120  Microbial metabolism in diverse environments
gte01130  Biosynthesis of antibiotics
gte01200  Carbon metabolism
Module
gte_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_7940
   00020 Citrate cycle (TCA cycle)
    GTCCBUS3UF5_7940
   00620 Pyruvate metabolism
    GTCCBUS3UF5_7940
Enzymes [BR:gte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GTCCBUS3UF5_7940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 RnfC_N HlyD_3 GCV_H HlyD_D23 ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: AEV18117
UniProt: G8N711
Position
752714..754024
Genome map
AA seq 436 aa AA seqDB search
MVVEVTLPKLSDSHDESFITFWHVSEGDAVEKGATLVEVQTEKAVSEIHAPESGTVKEIK
KKRGDTAKVGEVLAVIAVETFAPDGGDPQTEIKITPRVKKLAKELGVDWSTVTPTGANGK
ITEEDIRRAASAGKQRTPQKTFVAAPSVRKFAREQNVSLEEITPSGKNGRILKSDIEAAL
SVRQQKATDEAAASVEIVKKQESREKVRRVPLTGIRKAIAQAMVRSMRTIPQVTHFGEAD
ATRLVQHRRRIKPLAEQQGVKLTYLAYVVKALAAVLKKYPMLNASLDEEREEIVIHEFIH
IGFAVDTDRGLLVPVIRDADQKSLFQIAKEIEELTAKARAGTIQAVEMSGGTCTVSNIGS
ANGSWFTPIIHYPQSCLLGIGKVEKKPVVVDDSIEIASVMPLSLTYDHRLIDGMMAQHAL
NECQTYLSEPDWLLVM
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcgaagtgacattgcccaaattatccgattcccatgatgaaagtttcattacg
ttttggcacgtttccgaaggagatgcggtggaaaaaggagccacgctagtggaagtgcaa
acagaaaaggccgtttcagaaattcacgctcccgagtcaggaacagtaaaagagatcaaa
aagaaacgaggggatacggccaaggtcggcgaagtactggccgtcattgccgtcgaaacg
tttgctccggacggcggagatccgcagacagagatcaagatcaccccacgcgtaaaaaaa
ctggccaaggagcttggcgtcgattggagtacggtcacaccgacgggggcgaacggcaaa
atcacggaagaggatattcgtcgtgcggcgagcgcgggaaaacaaaggactcctcaaaaa
acattcgtggctgccccgtcagtgcgaaagtttgcccgcgagcagaacgtgtctttagag
gaaatcactccaagcggaaagaacggaagaatattgaaaagcgatattgaagcagcactg
tcggttcggcagcaaaaagcaaccgatgaggctgctgccagtgttgagattgtcaagaag
caggaaagccgggaaaaagtgcgccgagtgccgctgacaggcatccgcaaggctatcgcc
caagcgatggtgcggtcaatgcggaccattccgcaagtcacccattttggcgaggccgat
gcgacccgtcttgttcaacatcgccgacggatcaaaccgctagctgagcaacaaggggtg
aaactgacctatttagcctatgtggtaaaagcactggcggcggtgttgaaaaagtatcca
atgctcaacgcttcgcttgatgaggaacgagaagaaatcgtcattcacgaattcattcac
attgggtttgcggttgacactgaccgtggattgctcgtcccggtgattcgtgatgcggat
caaaaatcgttgttccaaattgcgaaagaaattgaagaattgacggcgaaggcgagagcg
ggaacgattcaagcggtggagatgagcggagggacatgcacggtttcgaacatcggctcg
gccaatggttcgtggttcacgccgattattcattatccacagtcttgtcttttaggaatc
gggaaagttgagaaaaaaccggtggtcgtcgatgattcgattgagattgcttctgtgatg
ccgctgtctcttacttacgatcaccgtcttattgatgggatgatggctcaacacgcctta
aatgaatgtcaaacgtacttgtctgaaccggattggctgcttgttatgtga

DBGET integrated database retrieval system