KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_9110Help
Entry
GTCCBUS3UF5_9110  CDS       T01676                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase 2
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GTCCBUS3UF5_9110
   00052 Galactose metabolism
    GTCCBUS3UF5_9110
   00500 Starch and sucrose metabolism
    GTCCBUS3UF5_9110
   00520 Amino sugar and nucleotide sugar metabolism
    GTCCBUS3UF5_9110
Enzymes [BR:gte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GTCCBUS3UF5_9110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
851396..852283
Genome map
AA seq 295 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAIASGIEDIIIVTGKG
KRAIEDHFDYAFELEQMLKQKGKLDLLEKVKEPSKVDIHYIRQKEPKGLGHAVWCARNFI
GDEPFAVLLGDDIVQAEKPCLKQLIEQYEQTFSSVIGVKRVPEEETHRYGIIDPLEQQGR
RYQVRRFVEKPAPGTAPSNLAIVGRYVLTPEIFLFLEKQEAGAGGEIQLTDAIGRLNEIQ
RVFAYEFEGKRYDVGEKLGFIETTIEFALQNEELRDDLLSFLERVVAEAKGSKNN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacgcaaagcgatcattccggcggccgggcttgggacgcggtttctgccg
gcgacgaaggcaatgccgaaggagatgcttccgatcgttgataagccgacgattcaatat
attgtcgaagaagccatcgcctcaggcattgaggacattattatcgtcaccgggaaaggg
aagcgggcgattgaggatcattttgactacgcgtttgagctggaacagatgctcaagcaa
aaagggaagctggatctgcttgagaaagtgaaagagccgtcgaaggtggacatccactac
attcgccaaaaagagccgaaagggctcgggcatgcggtttggtgcgcgcgcaatttcatt
ggagacgagccgtttgcggtgttgttgggcgatgatatcgtccaggcggaaaagccttgt
ttaaaacagctcattgagcagtatgaacaaacgttcagctcggtgattggtgtcaagcgc
gtgccggaggaagaaacgcatcgctacgggatcatcgacccgctcgagcagcaaggccgg
cgctaccaagtgcgccgcttcgtggaaaaaccagctccgggcacagcgccgtcgaacttg
gcgatcgtcggccgctacgtgttgacgccggaaattttcttgtttttagagaaacaggaa
gccggcgcaggcggggagattcagctcaccgatgcgatcgggcggttgaatgaaattcag
cgcgtgtttgcctatgaatttgaaggaaagcggtacgatgtcggcgaaaagctcggcttt
atcgaaacgacgattgagtttgccttgcaaaacgaggagctgcgggatgacttgctttcg
tttttggagcgggtggtggcagaggcgaagggatcgaagaacaactaa

DBGET integrated database retrieval system