KEGG   Geobacillus thermoleovorans: GTCCBUS3UF5_960Help
Entry
GTCCBUS3UF5_960   CDS       T01676                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
gte  Geobacillus thermoleovorans
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:gte00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105134..106609
Genome map
AA seq 491 aa AA seqDB search
MMAKEVRVRYAPSPTGHLHIGGARTALFNYLFARHHGGKMIVRIEDTDIERNVEGGEKSQ
LENLKWLGIDYDESIDQDGGYGPYRQTERLDIYRKYVNELLEQGHAYKCFCTPEELERER
EAQRAAGIAAPQYSGKCRHLTPEQVAELEAQGKPYTIRLKVPEGKTYEFYDLVRGKVVFE
SKDVGGDWVIVKANGIPTYNFAVVIDDHLMEISHVFRGEEHLSNTPKQLMVYEYFGWEPP
QFAHLTLIVNEQRKKLSKRDESIIQFVSQYKELGYLPEAMFNFFALLGWSPEGEEEIFTK
DELIRMFDVSRLSKSPSMFDTKKLTWMNNQYIKKLDLDRLVELALPHLVKAGRLPADMTD
EQRQWARDLIALYQEQMSYGAEIVPLSELFFKEEIDYEDEARQVLAEEQVPAVLSTFLES
VRELEPFTADEIKAAIKAVQKATGQKGKKLFMPIRAAVTGQTHGPELPFAIQLLGKEKVI
ERLERALQEKF
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaagaggtgcgcgtgcgctatgcgccgagcccaaccggccatttgcatatc
ggcggggcgcggacagcgctgtttaactatttgtttgcccgccatcacggtggaaaaatg
atcgtccgcatcgaggatacggatattgaacggaacgtcgaaggcggcgaaaagtcgcag
ctcgaaaacttaaaatggctcggcattgattatgatgaatcgattgatcaagatggcggc
tacgggccgtaccggcaaacggagcggctcgatatttaccgaaaatatgtgaatgaattg
cttgagcaagggcatgcgtacaaatgtttttgcacgccggaagagctcgagcgcgagcgg
gaggcgcagcgggcggccggcatcgccgctccgcagtacagcggcaaatgccgccatttg
acgccggagcaggtcgcggagctcgaggcgcaagggaagccgtatacgatccgcctgaag
gtgccggaagggaaaacgtacgaattttacgatttagtgcgcggcaaagtggtgtttgaa
tcgaaagatgtcggcggcgattgggtgattgtcaaggcgaatggcattccgacatacaat
ttcgctgttgtcatcgacgaccatttaatggaaatcagccatgtgtttcgcggtgaggaa
catttgtccaatacgccgaagcagctcatggtatacgagtatttcggctgggagccgccg
cagttcgcgcacttgacgttgatcgtcaacgagcagcggaaaaagctgtcgaagcgcgat
gaatccatcattcagttcgtctcgcaatacaaagaacttggctatttgccggaagcgatg
ttcaactttttcgctttgcttggctggtcgccggaaggagaggaagaaatttttacgaaa
gacgaactgatccgcatgttcgatgtctcccggctgtcaaaatcgccgtccatgtttgat
acgaaaaagctgacatggatgaacaaccaatatatcaaaaagcttgatcttgaccggctt
gtcgagctggccttgccgcatttagtgaaagccgggcgcctgccggcggatatgacggac
gaacagcggcaatgggcgcgcgatttaattgctttgtatcaagagcaaatgagctacggg
gcggagatcgtcccgctgtctgagctgttctttaaagaagaaatcgactacgaggacgag
gcgcgtcaagtgcttgctgaagagcaagtgccggctgtgctttccaccttccttgagagc
gtgcgtgagcttgagccgtttacggcagacgagattaaagcggccattaaagcggtgcaa
aaggcgaccgggcaaaaagggaaaaagttgtttatgccgatccgcgcggcggtgacggga
caaacgcacggaccggagctgccgtttgccattcagttgctcggcaaagaaaaagtgatc
gagcggctggagcgggcgttgcaagaaaaattttaa

DBGET integrated database retrieval system