KEGG   Geobacillus thermoglucosidasius: Geoth_0041Help
Entry
Geoth_0041        CDS       T01531                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gth00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Geoth_0041
DNA repair and recombination proteins [BR:gth03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Geoth_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29435..30031
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLTMKEDTVLEFAKALVDAKRNIRYCTIC
GHITDTDPCYICKDERRDRTTICVVQDPKDVIAMEKMKEYNGLYHVLHGAISPMEGIGPE
DIKIAELLKRLQDEAVQEVILATNPNIEGEATAMYISRLLKPTGIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagaaccaatatctaagttaatcgatagttttatgaagctgcccggaatc
ggaccaaaaacagctgttcgtctcgcgttttttgttttaacaatgaaggaagatactgtg
ttggaatttgctaaagcgcttgtggatgccaaacgcaatattagatattgtacgatttgt
gggcatattaccgatacagatccttgctatatttgcaaagatgagagacgggatcggaca
acaatctgtgttgtgcaagatccgaaagatgtcattgcgatggaaaaaatgaaagaatac
aacgggctttaccatgtgttgcatggcgccatttctccaatggagggcatcggtccggaa
gatataaaaattgcggagttattgaaaaggttgcaggatgaagctgtacaagaagtgatt
ttggcaacaaacccgaacattgaaggggaagcgaccgcgatgtatatatcgcgtttgtta
aaaccaacgggaataaaagtgacgagaattgcccatggtttgccagtgggcggagattta
gaatatgccgatgaagtgacgctttcgaaagctttggaaggacgtcgagagttatag

DBGET integrated database retrieval system