KEGG   Geobacillus thermoglucosidasius: Geoth_0094Help
Entry
Geoth_0094        CDS       T01531                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Geoth_0094
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Geoth_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84243..84770
Genome map
AA seq 175 aa AA seqDB search
MENHAYIALGSNIGDRFFYLREAVKMLDSHQQISVAAASSIYETEPVGYIHQNKFLNMVV
KIYTSLSPFALLDVTQKIEQNFGRKREMRWGPRTLDLDILLYNHENIETEQLIIPHPRMT
ERAFVMIPLLELNRDIHIPNVTQCLLHLVDRLPDKEGVRVWKQKNGEDVFALFES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcacgcatacatcgcacttggttctaatatcggtgatcgcttcttttatttg
cgggaagctgtcaaaatgttggatagtcatcaacaaatttccgtcgctgctgcttcatct
atttatgaaaccgaaccagtcggctatatccatcaaaataagtttttaaatatggtcgtc
aaaatttatacttctctttctccttttgcattgctagatgttacacaaaaaatcgaacaa
aattttgggagaaaaagggaaatgcgttgggggccgcgaacgttggaccttgacatttta
ttatataatcacgaaaatattgaaacagaacaacttatcattcctcatccgcgtatgaca
gagcgtgcgtttgtgatgattccattgttggaattaaatcgcgatatccatattccgaat
gtcactcaatgtctattgcaccttgtagatcgactacctgacaaagaaggagttcgtgta
tggaagcagaaaaatggggaagacgtattcgcgcttttcgaaagctaa

DBGET integrated database retrieval system