KEGG   Geobacillus thermoglucosidasius: Geoth_0107Help
Entry
Geoth_0107        CDS       T01531                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:gth00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Geoth_0107
Enzymes [BR:gth01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Geoth_0107
Amino acid related enzymes [BR:gth01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Geoth_0107
Transfer RNA biogenesis [BR:gth03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Geoth_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
109482..110942
Genome map
AA seq 486 aa AA seqDB search
MSQEVRVRYAPSPTGHLHIGGARTALFNYLFARHHNGKFIVRIEDTDIERNVEGGEQSQL
ENLKWLGIDYDESVDKDGGYGPYRQTERLDIYRKYVNELLEKGYAYKCFCTPEELEQERE
AQRAAGIAAPQYSGKCRHLTKEQIAQLEAEGKPYTIRVKVPEGKVYEFEDIVRGKVTFES
KDIGDWVIMKANGIPTYNFAVVIDDHLMKITHVFRGEEHLSNTPKQLMIYDYFGWEPPQF
GHLTLIVNENRKKLSKRDESIIQFVSQYKELGYLPEALFNFFALLGWSPEGEEEIFSKEE
LIRIFDVSRLSKSPSMFDTKKLTWMNNQYIKKLDLDRLVEISLPHLIKAGRLPEQMSEEQ
RQWARDLIALYQEQMSYGAEIVQLSELFFKEDIEYNEEAKEVLSGEQVPDVLKAFLEEVK
QLDPFTAENIKAAIKSVQKSTGQKGKKLFMPIRVAATGQTHGPELPVALQLLGKEKVISR
LEKVVH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagaagtgagagtgcgatatgcaccgagtccaacaggccatttacacattggc
ggcgcaagaacggcgttatttaactatttgttcgctcgccatcataatggaaaatttatt
gtgcgcattgaagatacggatattgaacgaaacgtagagggcggagaacaatcgcagtta
gaaaacttaaaatggttaggcatcgattatgacgaatcggtggataaagacggtggatac
ggtccatatcgccagacggagcgtcttgatatatatcgcaaatacgtcaatgaactttta
gaaaaaggatatgcgtacaaatgtttctgcacgccggaagagcttgaacaagagcgggaa
gcgcaaagagcggcaggcatcgctgcaccgcaatatagtgggaaatgccgccatttaaca
aaagaacaaattgcgcaattggaagcggaaggaaagccatatacgattcgcgtaaaagtg
ccggaaggaaaagtatatgaatttgaagatatcgtgcgcggaaaagtgacgtttgaatca
aaggatattggcgattgggtcattatgaaagcgaacggcattccaacatacaattttgct
gtcgtgattgatgatcatttaatgaaaatcacccatgtgttccgcggcgaggaacatttg
tcgaacacgccgaaacaattgatgatttatgactatttcggctgggagccgccgcaattt
ggccatttaacgttaatcgtgaatgaaaatcgcaaaaagctttcgaaacgtgacgaatcg
attattcaatttgtttcccaatataaagagcttggctatttgccggaagcattgtttaac
ttctttgcgctgctcggctggtcgccagaaggggaagaagaaatcttctcgaaagaggaa
ctcattcgcattttcgatgtttcccggttgtcgaaatcaccatccatgttcgatacgaaa
aagttgacatggatgaataaccaatatattaaaaaattagatttggaccggcttgtagag
atttctttgccgcatttgatcaaagccggccggctgccagaacaaatgagcgaagaacaa
cggcaatgggcgcgtgatttgattgccttataccaagaacaaatgagctatggcgccgaa
attgtacaattatcggagttgttctttaaagaggacattgagtataatgaagaagcaaaa
gaagtgctatcaggcgaacaagtccctgatgtgttaaaagcatttctagaagaagtgaaa
cagctcgatccatttacagcggaaaatattaaagcggcaattaaatcagtgcaaaaatcg
acagggcaaaaaggaaaaaaattgtttatgccaattcgcgtcgctgcaacagggcaaaca
cacggtccggaactgccagttgcgcttcaattattaggaaaagaaaaagtcatcagccga
ttagaaaaagtggttcattaa

DBGET integrated database retrieval system