KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0172Help
Entry
Geoth_0172        CDS       T01531                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00220  Arginine biosynthesis
gth00330  Arginine and proline metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01130  Biosynthesis of antibiotics
gth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Geoth_0172
   00330 Arginine and proline metabolism
    Geoth_0172
Enzymes [BR:gth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Geoth_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEH46232
Position
163914..164834
Genome map
AA seq 306 aa AA seqDB search
MERGNSVKKVSIIGVPMDLGQTRRGVDMGPSAMRYAGIIERLERLHYEIEDLGDVSIGKM
EWSDDEGLRLNLRNLKAVAKTNEKLAEMVDDVVQRGRFPLVLGGDHSIAIGTLAGVAKHY
QNLGVIWYDAHGDLNTAETSPSGNIHGMSLAVCLGLGHPYLTKIGGYSPKVKPENVVLIG
VRSLDEGEKQLIREKGIKVYTMHEVDRLGMAAVMEETIAYLQGRTDGVHLSLDLDGLDPH
DAPGVGTPVIGGLTYRESHLAMEMLAEAQLITSAEFVEVNPILDERNKTASVAVGLMGSL
FGEKLV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggggaaacagtgtgaagaaagtatcgatcattggagtgccaatggatttaggg
cagacacgccgcggtgtggatatggggccgagcgccatgcgttatgcaggaatcatcgag
aggctggaacgccttcattatgagattgaagatttgggcgatgtttcaattggaaaaatg
gaatggtctgatgatgaagggttacggcttaatttgcgcaatttgaaagcggttgcaaaa
acaaatgaaaaattggcggagatggtggacgatgtagtccaaagaggtcgctttcctctt
gtgcttggcggcgaccatagcattgccatcgggacattagctggtgtcgcaaagcattat
caaaatttgggagttatttggtatgatgcccatggcgatttaaatacagcggaaacttct
ccgtcagggaatattcatgggatgtcgctcgctgtgtgccttggtttggggcatccatat
ttgacgaagatcggcggatacagtccaaaagtaaaaccggaaaatgttgttcttattggt
gtccgttctcttgatgaaggggaaaaacaattaatccgtgaaaaggggattaaggtatat
acgatgcatgaagtagatcgcctcggaatggcggctgtgatggaggaaacgattgcttat
ttgcaaggacggacagacggcgtgcatttatctcttgatttagatgggcttgatccgcac
gatgctccgggagtgggcacgccggttatcgggggccttacttatcgcgaaagccatttg
gcaatggaaatgcttgcagaagcgcaactaattacatcagcagaatttgtagaagtgaat
ccgattttagatgaacggaataagactgcttccgtcgcggtgggattgatggggtccctt
tttggagaaaaattagtgtag

DBGET integrated database retrieval system