KEGG   Geobacillus thermoglucosidasius: Geoth_0216Help
Entry
Geoth_0216        CDS       T01531                                 

Definition
(RefSeq) Threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Geoth_0216
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Geoth_0216
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Geoth_0216
Enzymes [BR:gth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Geoth_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213366..214592
Genome map
AA seq 408 aa AA seqDB search
MPFSYVSHLYCPKCQKTYGTNKKHQLCECGSPLLVAYHLDALRADLSREIIASREPNLWR
YHELLPVENPEHIVSLGEGMTPLVPMPRLGKDMDIEQLYMKDEGVIPTGTFKARGAAVGI
SKAKELGVKKLAMPTNGNAGAAWSLYAARAGIQVTVVMPVDAPTITRNECAIAGADLYLV
NGLISDAGAIVSKAIQERNLYDASTLKEPYRIEGKKTMGLEIAEQFSWQLPDVILYPTGG
GVGLIGIYKALKELQDLGWVQGKMPRLVAVQAQNCAPIVKAWNERKRVSEFWPNSSTVAF
GINVPKALGDFLVLDALYKTDGCAIAVEDDAIINEQRNVANLEGAFICPEGAAAFVAARR
LRERGWIRRGERVVVLNTGIGLKYTHTVSIEVPILQPGDHLPERKDYS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgccattcagttatgtatcccatttgtactgtccgaagtgtcaaaaaacatatggcaca
aataaaaagcatcagctatgcgagtgcggttcgccgctgcttgtcgcataccatcttgac
gcgttacgcgcagacctaagccgtgaaattattgcaagcagagagcctaacctatggcgg
taccacgaattattacccgtagaaaatcctgaacatatcgtttctttaggagaaggcatg
acgccgcttgttcctatgcctcggcttggtaaagacatggatatcgagcagttatatatg
aaggacgaaggagtaattccgacaggaacctttaaagcgagaggggcagctgttggtata
tcaaaagcaaaagaactgggagtcaaaaagttggctatgccgacaaatggaaatgcagga
gcggcgtggtcgctttatgcagctagggcagggattcaagtaactgttgtaatgccagtg
gacgctccaacgattacaaggaacgaatgtgccatcgctggagccgatctttacttggtg
aacggtttaatcagcgatgcaggggccatagtcagcaaagcaatccaggagcgaaacctg
tatgacgcctctacgcttaaagagccttaccgtattgaaggtaagaaaacgatgggattg
gagatagcggagcaattctcttggcaactccctgatgtcattttatatccgaccggggga
ggtgtcgggctgatagggatttataaggcgctgaaagaattgcaggatcttggatgggtg
caaggaaagatgccaaggctggtggctgtacaggcgcaaaattgcgctcctattgtaaaa
gcctggaatgaaaggaaacgggtatcggaattctggccaaactcttcgactgttgctttc
gggattaatgtgccgaaagctttgggggacttcctcgtattagatgctctgtataaaaca
gatgggtgcgcgattgctgtagaagacgatgccatcattaatgagcagcgaaacgttgct
aatctcgagggggcttttatttgtccggaaggggctgcggcgtttgtagctgcccgccgt
ctgcgcgagagaggatggattcgtaggggagaaagggttgtcgttcttaatacgggaatt
ggattgaaatatacgcataccgtgagtatcgaggtgccaatcctgcaaccaggtgatcat
ttacctgagaggaaagattattcttga

DBGET integrated database retrieval system