KEGG   Geobacillus thermoglucosidasius: Geoth_0234Help
Entry
Geoth_0234        CDS       T01531                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Geoth_0234
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Geoth_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233721..234608
Genome map
AA seq 295 aa AA seqDB search
MTKPVITVVGSINMDLVTIASRFPSQGETILGEEFHLIPGGKGANQAVAAARLGAEVHMI
GAVGTDPFGNELLRSLEREGVHIDNVKPVTHKGTGIASITISEQDNRIIVVPGANHALRP
EDIDRYEEIIAKSDVCVLQLEIPLSVVERAVFLAKKHHVRVILNPAPAQPLPQKLIEQAD
FLTPNEHEREIIFEQVDVDVFADKVIVTEGARGVTIRKDGKQVHIPGFCVPVVDTTGAGD
TFNGALAVALSKGMSLEDACRFANAAAALSVTKLGAQGGMPTEEEVERFLRENKG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaccggtgattactgttgttggaagcatcaacatggatcttgtgacgatcgct
tctcgttttccatcgcaaggagaaacaattttaggagaggagtttcatctcattcctggc
ggaaaaggagctaaccaagcggtggctgccgcgcggcttggcgcggaggtacatatgatt
ggggccgtcggaacggatccatttggaaacgagcttcttcgctcattggagcgggaaggt
gttcatatcgataatgtgaaaccggttacacataaaggcactggtattgcttcgatcacg
atttcggaacaagataaccggattattgttgtgccgggagcgaatcatgcgcttcgccca
gaagacattgaccggtacgaagagatcattgccaagagcgatgtatgtgtactgcaactg
gaaattccgctttccgttgtagaaagagccgtctttttagcgaaaaaacatcatgtgcgt
gtcattttaaatccagcgccagcgcagccgttgccacaaaaactcatcgagcaggccgat
tttcttacaccaaatgaacatgagcgggagattatttttgagcaagtggatgtggatgtg
tttgctgataaagtgattgtcacagagggagcacgcggcgtgacgattcggaaagatgga
aaacaggtgcacataccaggcttttgcgttccggtcgtggacacgacaggagcaggagat
acattcaacggtgcgttggcggtcgcgttaagcaaaggaatgagtttggaagatgcatgt
cgctttgccaacgctgcggcggcgctatcggtgacaaaacttggcgcgcaaggcggaatg
ccgacggaggaagaggtagaacgatttttaagagaaaataaaggataa

DBGET integrated database retrieval system