KEGG   Geobacillus thermoglucosidasius: Geoth_0425Help
Entry
Geoth_0425        CDS       T01531                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Geoth_0425
  Amino acid metabolism
   00340 Histidine metabolism
    Geoth_0425
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Geoth_0425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447843..449111
Genome map
AA seq 422 aa AA seqDB search
MKIVRVKSRVSLRRTIESGTEEQRRAVLEIISTVRARGDEALKSYTEKFDGVRLDSLRVT
NEEIEAAYQNVSEEALRIIREAAENIRDYHDRQKRESWIIAKEDGTMLGQKITPLDAVGL
YVPGGTAAYPSSVLMNVIPAQVAGVKRIVITSPPNKNGTLPAGVLVAASELGVKEIYKVG
GAQAIAALAYGTETIRPVDKIFGPGNIYVALAKREVFGQVAIDMIAGPSEIVVLADETAN
VNEIAADLLSQAEHDERASAILVTPSMKLALAVASEVKKQLETLPRKAIAVSALENYGAI
YVTETLAEAVEVVNELAPEHLEVMTAEPMQLLGQIRHAGAIFLGRFSSEPVGDYFAGPNH
VLPTNGTARFSSGLSVDEFVKKSSIIFYSEPALQRNAGKIAAFARLEGLEAHARAVEERF
KK
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcgtacgagtgaaaagccgtgtatcattgcgccgcacgattgagtcagggacg
gaagaacagcggcgtgcggtgttggagattatttccactgtgcgcgcccgcggcgatgaa
gccttgaaaagctatacggaaaaattcgatggcgtgcggctcgattcgctgcgcgtgaca
aatgaagaaatcgaagcggcgtatcaaaacgtaagcgaggaagcgcttcgcatcattcgc
gaagcggcggaaaacattcgcgattatcacgatcggcaaaagagggagtcatggatcatt
gcaaaagaagacggcacgatgctcgggcaaaaaataacgccgctcgatgcggttgggctg
tacgttccaggagggacggcggcatacccgtcatcggtgcttatgaatgtcattcctgct
caagtggcgggagtgaaacggatcgtgatcacatctccgccaaataaaaacgggacgctc
ccggccggcgtattggtcgcggccagtgaattgggcgtgaaagaaatctataaagtcggc
ggcgcgcaggcgattgccgcgctcgcatatggaacggaaacgattcgcccggtcgataaa
attttcggaccaggcaacatctatgtggcgcttgccaaacgggaagtgtttggacaagtg
gcgattgacatgattgccgggccaagcgaaatcgtcgtgctggccgatgaaacggcaaat
gtgaacgaaatcgccgctgacttgttgtcacaagccgaacatgatgagcgtgcttcggcg
attctcgtcacgccgtcgatgaaattggcgctcgcggtcgcaagcgaggtcaaaaaacag
cttgaaacgctgccgcgcaaagcgattgccgtttcggcgctcgaaaattacggagccatt
tatgttacagaaacgcttgcggaagcggtggaagttgtcaatgaactggcgccagagcat
ttggaagtgatgacagccgaaccgatgcagcttcttggccaaatccgccacgcgggagcg
atttttttagggcgcttcagctctgagcctgtcggcgattatttcgccggcccgaaccac
gtgctgccgacgaacggcacggcccggttttcgagcggattaagcgtggatgagtttgtg
aaaaaatcgagcatcattttttacagtgaaccggcgctacaacgaaacgccggaaaaatc
gcggcattcgcaagacttgaagggcttgaggcacatgcgcgcgccgttgaggaacgtttc
aaaaaataa

DBGET integrated database retrieval system