KEGG   Geobacillus thermoglucosidasius: Geoth_0444Help
Entry
Geoth_0444        CDS       T01531                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geoth_0444
   01230 Biosynthesis of amino acids
    Geoth_0444
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_0444
   00051 Fructose and mannose metabolism
    Geoth_0444
   00562 Inositol phosphate metabolism
    Geoth_0444
Enzymes [BR:gth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Geoth_0444
Exosome [BR:gth04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Geoth_0444
  Exosomal proteins of bladder cancer cells
   Geoth_0444
  Exosomal proteins of melanoma cells
   Geoth_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
465375..466136
Genome map
AA seq 253 aa AA seqDB search
MRKRIIAGNWKMHKTLPEAVSFVEEVKRLVPPAEQVDSVICAPFLFLDRLVQNVQGSDLK
IGAQNMHFEDKGAFTGEISPVALKDIGVAYVIIGHSERREMFAETDETVNKKVHAAFKHG
LIPIVCCGETLEQRESGKTNDIVGAQVEKALAGLTAEQAKQVVIAYEPIWAIGTGKSSTA
EDANEVCGHIRSVIAKIFSPEVAEAVRIQYGGSVKPENIREFLAQEHIDGALVGGASLDP
KSFLQLVEAGQHE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacgaattatcgcaggaaactggaaaatgcataaaacattgccggaggcagta
agcttcgtggaagaagttaaacggcttgtgccgccggcagaacaagttgactctgtcatt
tgcgcccctttcttgtttttagaccgtcttgtccaaaatgtacaaggctctgatttaaaa
atcggtgcgcaaaacatgcattttgaagacaaaggggcgtttactggcgaaatcagcccg
gttgcgctgaaagatatcggcgtggcgtatgtcattatcggccactccgagcgccgcgaa
atgtttgcggagacggatgaaaccgtcaataaaaaagtgcatgctgcctttaagcatggg
ctgattccgatcgtctgctgcggcgaaacgctggaacagcgggaaagcggcaaaacaaat
gacatcgtcggcgcgcaagttgaaaaagcgcttgccggtttaactgcggagcaagcgaaa
caagtggtgatcgcctatgagccgatttgggcgattggcactggcaaatcatcgacggca
gaagatgccaacgaagtgtgcggccatattcgttcggtcatcgccaaaatcttttctccg
gaagtggctgaagccgtgcgcattcagtatggcggcagcgtcaaaccggaaaacatccgc
gaatttttagcgcaagaacatattgatggcgcccttgtcggcggcgcaagcctcgatccg
aaatcatttttacaattagtggaggctggacagcatgagtaa

DBGET integrated database retrieval system