KEGG   Geobacillus thermoglucosidasius: Geoth_0449Help
Entry
Geoth_0449        CDS       T01531                                 

Definition
carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gth  Geobacillus thermoglucosidasius
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
470553..471293
Genome map
AA seq 246 aa AA seqDB search
MKVVPPKPFTFEAGERAVLLLHGFTGNSSDVRMLGRFLEAKGYTCHAPIYKGHGVPPEEL
VHTGPDDWWQDVINAYEFLKNKGYEKIAVAGLSLGGVFSLKLGYTVPVVGIIPMCAPMYI
KSEETMYEGVLKYAREYKKREGKTPEQIEEEMEAFQKTPMKTLKALQQLIADVRERIDLI
YAPTFVVQARHDEMINPDSANIIYNGIESPVKKIKWYEESGHVITLDKEKEQLHEDIYEF
LESLDW
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgttccaccaaaaccatttacgtttgaagcaggagaacgcgcagttttgttg
ctgcacggttttaccggaaactcgtcagatgtcagaatgttggggcgctttcttgaagca
aaaggatacacatgccatgcaccaatttataaagggcacggggtgccgccagaagagctt
gtgcacactggaccggacgattggtggcaagatgtgatcaacgcctatgaatttttaaag
aataaaggatacgaaaaaatcgcggttgccggactgtcgcttggaggcgtattttctctg
aaattaggttacactgtacctgtagtgggaattattccaatgtgcgcgccgatgtatata
aaaagcgaagaaacgatgtatgaaggtgtgctaaagtatgcgcgcgaatataaaaaacgg
gaaggaaaaacgccggaacaaattgaagaagaaatggaagcatttcaaaagacgccgatg
aaaacgttaaaagcattgcagcagcttattgcggatgtgcgtgagcgtatcgatttgatt
tatgcgccgacatttgtcgtgcaagcgcgccacgatgaaatgattaaccctgatagcgcc
aatattatttataacggtattgaatcgcctgtgaaaaaaatcaagtggtatgaagagtca
ggacacgtcattacgctggataaagaaaaagaacagctgcatgaggatatttacgagttt
ttagaatcgctggattggtaa

DBGET integrated database retrieval system