KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0600Help
Entry
Geoth_0600        CDS       T01531                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00260  Glycine, serine and threonine metabolism
gth00750  Vitamin B6 metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01230  Biosynthesis of amino acids
Module
gth_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Geoth_0600
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Geoth_0600
Enzymes [BR:gth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Geoth_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH46610
Position
605068..606129
Genome map
AA seq 353 aa AA seqDB search
MTWKGLLYAYREFLPINENTPMLTLNEGNTPLIPLPRLSEKLGVELYVKVEGANPTGSFK
DRGMVMAVAKAKESGSHTIICASTGNTSASAAAYAARAGLRCIVVIPNGKIAMGKLAQAV
MYGAEIFAIEGNFDEALKMVRRLSDMAPITLVNSVNPYRIEGQKTAAFEICDQLGKAPDV
LAIPVGNAGNITAYWKGFKEYHAAKQTGLPQMRGFEAEGAAAIVRNQVIEHPETIATAIR
IGNPASWEKAVQAAAESNGKIDEVSDAEIVEAYKLLAREEGIFAEPASCASIAGVIKQRK
RNEIENGSTVVAVLTGNGLKDPAIAMEVAEIEPTVLANDETVVFEHIQGVVHQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacatggaaaggtttgctgtacgcataccgcgaatttttgccaatcaatgaaaacacc
ccgatgcttactttgaatgaaggaaatacgccgcttattccgctgccgcggttgtcggaa
aagcttggcgttgaattatatgtcaaagtcgaaggggcaaacccgacaggatcattcaaa
gaccgcggcatggtgatggcggtcgcaaaggcgaaagaatcaggaagccatacgattatt
tgcgcttcgacaggcaacacgtccgcctccgcggcggcctacgcggcaagagcggggctg
cgctgcatagtggtgattccgaatggaaaaatcgcaatggggaaattagcgcaggcggtg
atgtacggagcggaaatttttgcgattgagggaaactttgatgaagcgttaaaaatggtg
cgccgccttagcgatatggccccaattacgcttgtcaattcggtaaatccataccgcatc
gaggggcagaaaacagcggcgtttgagatttgcgaccagcttggcaaagcgccggacgtg
cttgcgattccggtcggtaatgccgggaatattaccgcttattggaaaggatttaaagaa
tatcatgcggcaaaacaaacgggccttccgcaaatgcgcggattcgaagcggaaggagcg
gctgcgatcgtccgcaatcaagtcatcgagcatccggagacgatcgcgacggcgattcgc
atcggcaatccggcgagctgggaaaaagcggtgcaagcagcggcggagtcgaacggaaaa
attgatgaagtatctgatgcagaaattgtagaagcgtataaactgcttgcgcgggaggaa
gggatttttgccgaaccggcttcttgtgcatccattgcaggagtgatcaagcagcggaag
cggaatgaaattgaaaacggaagcaccgttgtggccgtattaaccggaaatggcctgaaa
gatccggccattgcgatggaagtggcagaaatcgagccaaccgtgcttgcaaacgacgaa
accgtcgtgtttgaacacattcaaggagttgtccatcaatga

DBGET integrated database retrieval system