KEGG   Geobacillus thermoglucosidasius: Geoth_0708Help
Entry
Geoth_0708        CDS       T01531                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Geoth_0708
Enzymes [BR:gth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Geoth_0708
Exosome [BR:gth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Geoth_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707711..709642
Genome map
AA seq 643 aa AA seqDB search
MSVVPPTDLEIYLFHEGSLYKSYELFGAHVIKQNDVVGTRFCVWAPHARQVRLVGSFNDW
NGTNFNLVKVSNQGVWTIFIPENLEGHLYKYEITTSDGNVVLKADPYAFHSELRPRTASI
VYDIKGYQWNDQTWRRKKQRKRIYDQPLFIYELHFGSWKKKENGNFYTYREMADELLPYV
MEHGFTHIELLPLVEHPLDRSWGYQGTGYYSATSRYGTPHDLMHFIDRFHQAGIGVIFDW
VPGHFCKDEHGLYMFDGAPTYEYDNIQDRENGEWGTANFDLGKPEVRSFLISNALFWMEY
FHVDGFRVDAVANMLYWPNREAAQQNPHAVQFLQKLNETVFAHDPGILMIAEDSTEWPLV
TAPTYAGGLGFNYKWNMGWMNDILTYMETAPEKRKHVHNKVTFSLLYAYSENFILPFSHD
EVVHGKKSLLNKMPGTYEEKFAQLRLLYGYLLTHPGKKLLFMGGEFAQFDEWKDAEQLDW
MLFDFEMHQKMNMYVKALLKCYKRCKSLYELDHSPDGFEWIDVHNAEQSIFSFVRRGKKE
NDLLVVVCNFTSKVYHDYKVGVPLFAKYREIISSDAAKFGGWGNVNAKPVAASKEPFHGK
PYHIRMTVPPFGISILRPVKKRGERSVDGKEKVHRHVIGGRAR
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgttgtccctccgaccgatctggaaatttatttatttcacgaaggcagcttatat
aaaagttatgaattgtttggcgcgcatgtgataaaacaaaacgacgttgtcggaacccgg
ttttgcgtatgggctccgcatgcgcggcaagtgcggttagtcggcagttttaatgactgg
aacggaactaattttaatcttgtaaaagtaagtaatcaaggtgtatggacgatttttatt
ccggaaaacttggaagggcatttatataaatacgaaattaccactagcgatggaaatgtc
gtgttaaaagcagatccatacgcgtttcactccgaattgcgcccccgtactgcctccatc
gtctacgacataaaaggttatcaatggaatgaccaaacatggcgacggaagaaacagcga
aagcgaatatatgaccagcctttgttcatttatgagcttcacttcggttcgtggaaaaag
aaagaaaacggcaatttttatacatatcgggagatggcagatgagttacttccatatgtg
atggaacatggttttacccacattgaattgcttccgctcgttgaacatccgcttgaccgc
tcctggggatatcaaggaacaggttattattcagcaacaagccgctacgggacgccgcat
gatttgatgcattttattgatcgcttccatcaagcgggcattggcgtcattttcgattgg
gttcccggccacttttgcaaagatgaacatggattatacatgtttgatggagcaccgaca
tatgaatatgacaacatacaagatcgggaaaatggcgaatggggcacggcgaattttgat
cttggcaagccggaagtccgcagctttttgatttccaatgcgttgttttggatggaatat
ttccacgtcgacggatttcgggtggatgcggtggccaatatgctgtattggccaaataga
gaggcagcacagcaaaacccgcatgctgttcagtttttgcaaaaattaaatgagaccgta
tttgcgcatgacccgggcatattgatgattgccgaagattcgacggaatggccgctcgtc
actgctccaacgtatgccggagggctggggtttaactataaatggaacatggggtggatg
aacgatattttaacatatatggaaacggcgccggagaagcgaaaacatgtgcacaataaa
gtaaccttttcccttttgtacgcgtattcggaaaattttattttacctttttcccacgat
gaggtcgtgcatggaaaaaaatcgctgctaaataaaatgccggggacgtatgaggaaaag
tttgcacaattaaggctgctgtatgggtatttgctaacacatcccggcaagaaactattg
tttatgggcggcgaatttgcccagtttgatgagtggaaggatgcagagcagctggattgg
atgctttttgatttcgagatgcaccagaaaatgaatatgtacgtgaaagcattattgaaa
tgttataagcgctgcaaatctttgtatgagctagaccattctccagacgggtttgagtgg
attgatgttcataacgctgaacaaagtattttctcatttgtccgcagaggaaaaaaagaa
aacgatttgcttgttgtcgtgtgcaattttaccagtaaagtgtatcacgattataaagtt
ggcgttccgctatttgccaaataccgggaaatcatcagcagcgatgcggccaaattcggg
gggtggggcaatgtcaatgcaaagccggttgcggcgagcaaagaaccgtttcatggaaag
ccgtatcatattcgcatgacggttccgccgtttggcatttccattttaagaccagtgaaa
aaacggggggagagaagcgttgatggcaaagaaaaagtgcatcgccatgttattggcggg
agggcaaggtag

DBGET integrated database retrieval system