KEGG   Geobacillus thermoglucosidasius: Geoth_0815Help
Entry
Geoth_0815        CDS       T01531                                 

Definition
alpha/beta fold family hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Geoth_0815
Enzymes [BR:gth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Geoth_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
788530..789321
Genome map
AA seq 263 aa AA seqDB search
MWTWEANEGKGTVVIVHGAAEHHGRYKWLIEQWVKSGYHVVAGDLPGQGRTTRRKRGHIL
SFDEYINEVADWITEARQFHVPVFLLGHSMGGLIAIRTLQEKKLPVQGVILSSPCLGLVS
YPSKGLDMLSRVLNHIAPSLLIDSGLSVELATRNKEVHEAGKQDELYVTKVSVRWYRELI
KAMELASRRIQRFPDIPLLLMQGGDDKIVDKTAVKEWFDRLPISEKVYKEWNQLYHEIFN
EPEREDVFLYAKSFLDTQCRLYR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtggacatgggaggcaaatgaagggaaaggaacagttgtgattgtccacggagcagca
gagcatcatggacgttataaatggctgatcgaacagtgggtaaaaagcggctatcatgtg
gtcgcaggcgatttgcctggacaagggcggacaacgagaagaaaacgcggacatattctg
tcgttcgatgaatatattaatgaggtggctgattggatcacagaagcgagacaatttcat
gtaccagtgtttcttctcggacatagcatgggagggcttatcgccatccgcacgttgcaa
gaaaaaaagcttcctgtgcaaggggttattttgtcctccccatgtttagggcttgtgtcg
tatccgtcaaaagggcttgatatgttatcaagagtattgaatcatattgcaccatccctt
ttaatcgattcgggattgtctgtcgaattggcgacaagaaataaagaagtacatgaggcg
ggaaaacaagatgaactttatgtgacgaaagtatctgtccgttggtaccgcgaactaata
aaggcgatggaattggcttcccgccgtattcagcgatttcctgacattccattgctgctg
atgcagggcggagacgataaaattgtcgataaaacagccgtaaaagaatggttcgatcgt
ttgccgatatcggaaaaagtgtataaagaatggaaccaattgtaccatgaaatttttaat
gaaccggagcgagaagatgttttcttatacgcaaaatcgtttttagatacacaatgccga
ctgtatcgttag

DBGET integrated database retrieval system