KEGG   Geobacillus thermoglucosidasius: Geoth_0866Help
Entry
Geoth_0866        CDS       T01531                                 

Definition
butyrate--CoA ligase (EC:6.2.1.2)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geoth_0866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_0866
   00620 Pyruvate metabolism
    Geoth_0866
   00640 Propanoate metabolism
    Geoth_0866
  Energy metabolism
   00680 Methane metabolism
    Geoth_0866
Enzymes [BR:gth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Geoth_0866
Lipid biosynthesis proteins [BR:gth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Geoth_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841543..843135
Genome map
AA seq 530 aa AA seqDB search
MKREDLIAPERYNLTVEIERHALANPDKTALKWESEQGETREITYGDLIKRANRIGNALL
KQGLEKGDKVLVMIPRLIEAYEVYLGALKAGLVVIPSSEMLRTKDLQYRISHGEAKAVVA
YEPYVDQFAPVEGMDHLVKFIVGKEKRDGWILLEEAMKAESDELATADTSRDDMAFLSYT
SGTTGYPKGVVHSHGWAYAHLRIAAKNWLCIGENDLVWATAGPGWQKWIWSPFLSTLGSG
ATGFVYYGRFDPEKYLQLLSKYEVNVLCCTPTEYRLMAKVPNIGDYNLSHLHSAVSAGEP
LNREVIDTFEKYFNIQVRDGYGQTGNTLLVGVMKGMKIKPGSMGKPTPGNRVEIINENGE
PCAVGEVGDIAVHVETPTLFKYYYKDPERTALQFRGDYYITGDKAKKDEDGYFWFEGRGD
DIIISSGYTIGPFEVEDALVKHPYVKECAVVASPDEVRGHVVKAFIVLREGVDKNDPTLI
PKLQEHVKQLTAPYKYPRKIEFVDDLPKTASGKIRRVELREREMRLAKRQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggaagatttaatcgctcctgaacgctataatttgacggtggaaatcgagagg
catgcgctggctaatcctgataaaaccgcattgaaatgggaaagcgaacaaggggaaacg
cgggagattacatatggtgatttaatcaaacgtgcgaaccggattggaaacgctttattg
aagcaagggcttgaaaaaggcgataaagtgcttgtcatgattcctcgcttaattgaagcg
tatgaagtatatttaggagcgttaaaggcaggcctggtcgtgattccaagttcggaaatg
ctgcggacgaaagatttgcaataccgcatttcccacggcgaggcaaaggcggttgttgca
tatgagccatatgtcgatcaatttgcgccggtagaaggcatggaccatctcgtgaaattc
attgtcggaaaagagaaacgggacggatggattcttttagaggaagcgatgaaagcggaa
agcgatgaactggctactgcagacacatcccgtgatgatatggcgtttttatcctataca
tcgggaacgaccggatatccgaaaggagtcgttcattcgcacggatgggcatatgcacat
ttgcgcatcgccgcgaagaattggttatgtattggagaaaatgatctcgtctgggcgacc
gccggcccaggctggcaaaaatggatttggagcccgtttttatcgacgcttggttctggt
gcaacagggtttgtctattatggacggtttgatccggaaaaatatttgcagcttttaagc
aagtatgaagtaaacgtgctttgttgcacgccgacggagtatcggctgatggcgaaagtg
ccgaacatcggtgattataatctctcgcatcttcatagtgccgtatccgccggggagccg
cttaaccgtgaagtgattgacacgtttgagaaatatttcaatattcaagtacgggatgga
tatgggcaaacgggaaatacgctgcttgtcggcgtcatgaaaggaatgaaaatcaaacca
ggatccatgggcaaaccaacgccgggaaatcgcgttgagattattaacgaaaacggcgaa
ccgtgcgccgtcggggaagttggcgacatcgccgtccatgtggaaactccgacgttattt
aaatattactacaaagatccagaacggacggcgctgcaattccgaggcgattattatatt
acgggggataaagcgaaaaaagatgaagatggatatttctggtttgaaggaagaggagat
gacattatcatcagctccggttatacaatcgggccgtttgaagtggaagatgcgcttgtc
aagcatccttacgtaaaagaatgcgctgtcgtcgccagtccggatgaagtgcgcggccat
gtcgtcaaagcgttcatcgttcttcgcgaaggagttgataaaaatgacccgacgctgatt
ccaaagctgcaggagcatgtgaaacaacttaccgcaccatataagtatccgcgcaaaatt
gaatttgtcgacgatttgccgaaaacggcatcaggaaaaatccgccgtgtggagctgcgc
gagcgcgaaatgcgccttgccaagcgtcaataa

DBGET integrated database retrieval system