KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0879Help
Entry
Geoth_0879        CDS       T01531                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00010  Glycolysis / Gluconeogenesis
gth00620  Pyruvate metabolism
gth00640  Propanoate metabolism
gth00680  Methane metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_0879
   00620 Pyruvate metabolism
    Geoth_0879
   00640 Propanoate metabolism
    Geoth_0879
  Energy metabolism
   00680 Methane metabolism
    Geoth_0879
Enzymes [BR:gth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Geoth_0879
Lipid biosynthesis proteins [BR:gth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Geoth_0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEH46877
Position
complement(852834..854492)
Genome map
AA seq 552 aa AA seqDB search
MPNKTFHSSFTASFSWETVFQHYDWNPRERFNVAHEVCDRYAEDPTRIALFYENHLGEKR
TITYRELRDWSNQMANVFRKLGVKRGDRVCALLPKNPALVIYILAAWKVGAVYVPLFTAF
GPQAIEYRINHSEAKVMLTNNEQRAKLPPREKIPTLEHIFVIDETNDHNDLSFWKTLSEE
SVDHQTEETTVDDLLAIQYTSGSTGMPKGAMWSHNLLINIYPYMRYAIGLRDDDVFLGGA
DPGWAYGLIFCTFAPMCFGVPIVFYEGPFKPDTYYSLMEKYHVTNFTYAPTAYRAMVAAG
AELINKYNIRVRAMSSAGEPLNPEVIRFFQKHLGVTVHDHYGLSETLMLIGNFNAIDMEI
RPGSMGWVLPGFEVALLNEEGVPVEDGNVGQIAFNTNSIPNVFKGYWKDPEKTAERLSGS
WFLTGDLATKDADGYFWFQGRADDIISSAGYRIGPFEIESCLIEHPAVVEAAAIGKPDPL
KGEIVKAFVVLADGFTPSDDLAQELSLFVKNRLSKHEYPREVEFVAELPKTPSGKIQRFI
LRNQESEKQKND
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacaaaacgttccattcttcattcaccgcttctttttcttgggagaccgtgttt
caacattacgactggaacccacgtgaacgtttcaatgtcgctcatgaagtatgtgaccgc
tatgcagaagatccgactcgcatcgccctgttttatgaaaaccatttaggagaaaagaga
accatcacctatcgagaattgcgggattggtcgaaccaaatggcaaatgtgttccgcaaa
cttggagtcaaaagaggagacagagtttgcgctcttttgcctaaaaatcctgctctagtc
atttatattttagctgcttggaaagttggcgcagtttatgttccgctatttacagcattt
ggcccacaggcgattgaataccggattaaccattctgaggcaaaagtgatgttgacgaat
aatgaacagcgtgcaaaattgccgccgagagaaaaaataccaacattagagcatattttt
gtcattgatgaaacaaatgaccataacgatttatctttttggaaaacgctttcagaagag
tctgtcgatcatcagaccgaagaaacgactgtggacgatttactggctatccaatataca
tccggatcgacaggaatgccgaaaggagccatgtggtcgcacaatttgctcattaatata
tatccgtatatgcgatatgccatcggtttgcgggatgatgatgtatttttagggggagcc
gatccgggatgggcttacgggctgatcttttgcacattcgcgccaatgtgtttcggtgtg
cccatcgtcttttacgaaggaccgtttaaaccggacacatactattctctgatggaaaaa
tatcatgtaacgaatttcacttacgctccgaccgcttatcgcgcgatggtcgcggcagga
gcagaattgatcaataaatacaacatccgcgtgcgggcaatgagttccgcaggagagccg
cttaatccggaagtgattcgctttttccaaaaacatttaggggtgaccgtccacgaccac
tacggtctgtcggaaacgttaatgctgattggcaatttcaacgcaattgacatggagata
cgccctggttcgatgggatgggtgctgccggggtttgaagtcgcattgctcaatgaagaa
ggcgttccggtagaggacggaaatgttggacaaattgcttttaacacgaattccattcca
aacgtgttcaaaggttattggaaagatcctgaaaaaacagcggagagattgtcaggaagc
tggttcctcaccggagatttggcaacgaaagacgccgacggatacttttggttccaaggc
agggccgatgatatcatctccagtgccggatatcgcatcgggccttttgaaattgagagt
tgcctcatcgaacatccagcggtagtggaagcagcggccattggaaagccagatccgtta
aaaggggaaatcgtcaaagccttcgtcgtactggcagatgggtttactccatcggacgat
ctggcgcaagaattatcattattcgtgaaaaaccgtttatcgaagcacgaataccctcgc
gaagtggaattcgtagcagaactgcctaagacgcctagcggcaaaattcagcgatttatc
cttcgcaatcaagaaagcgaaaaacagaaaaacgactaa

DBGET integrated database retrieval system