KEGG   Geobacillus thermoglucosidasius: Geoth_0897Help
Entry
Geoth_0897        CDS       T01531                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geoth_0897
   01230 Biosynthesis of amino acids
    Geoth_0897
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_0897
   00030 Pentose phosphate pathway
    Geoth_0897
   00051 Fructose and mannose metabolism
    Geoth_0897
   00052 Galactose metabolism
    Geoth_0897
  Energy metabolism
   00680 Methane metabolism
    Geoth_0897
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Geoth_0897
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Geoth_0897
Protein phosphatases and associated proteins [BR:gth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Geoth_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
871500..872459
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYHGYAGLIAGKIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQLKGIEQLKKYGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDVIARLKRGHERGKKHSIIIVAEGVGSGVEFGKKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQKMYLLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggtgtattaacaagtggcggagattcaccaggtatgaatgcggcgatc
cgcgccgtcgtccgcaaggcgatttaccatggagtagaagtatatggagtgtaccatggg
tatgctggtttaatcgctggaaaaataaaaaagttggaagtgggagatgtcggcgacatc
atccaccgcgggggaacgatactgtatacggcgcgctgtccggaatttaagacagaagag
gggcagttaaaagggattgaacaattgaaaaaatacggcatcgaaggattagtcgtgatt
ggtggggacggttcctaccaaggagcgaaaaagctaacagagcacggttttccttgtgtc
ggagtgccgggaacgattgacaatgacattcctggaacggattttacgattggatttgac
acggcgttaaatactgtaattgacgcgatcgacaaaattcgcgataccgctacatcacat
gaacggacatatgtaattgaagtaatgggacgccacgccggggatattgcgttatggtca
gggcttgccggaggggcggaaacgattttgattccagaagctgattacgatatggatgat
gttattgctcggttaaaacgcggacatgaacgcggcaaaaagcatagcattattatcgtt
gccgaaggtgtcggaagcggggtcgaatttggcaagaaaattcaagaagcgacagggttt
gaaacgcgcgttaccgtactggggcatgtgcagcgcggtggttctccaaccgcatttgac
cgcgtgttggccagccgtttaggtgctcgggcagtagaactattattagaaggcaaaggc
ggccgctgcgttggcatccaaaataatcagcttgtcgaccatgatattgcggaagcgttg
gccaacaaacatactattgatcaaaaaatgtatttgttgtcaaaagagctatccatttag

DBGET integrated database retrieval system