KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0897Help
Entry
Geoth_0897        CDS       T01531                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00010  Glycolysis / Gluconeogenesis
gth00030  Pentose phosphate pathway
gth00051  Fructose and mannose metabolism
gth00052  Galactose metabolism
gth00680  Methane metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
gth01230  Biosynthesis of amino acids
gth03018  RNA degradation
Module
gth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gth_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_0897
   00030 Pentose phosphate pathway
    Geoth_0897
   00051 Fructose and mannose metabolism
    Geoth_0897
   00052 Galactose metabolism
    Geoth_0897
  Energy metabolism
   00680 Methane metabolism
    Geoth_0897
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Geoth_0897
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Geoth_0897
Protein phosphatases and associated proteins [BR:gth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Geoth_0897
Messenger RNA biogenesis [BR:gth03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Geoth_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEH46895
Position
871500..872459
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGVYHGYAGLIAGKIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQLKGIEQLKKYGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMDDVIARLKRGHERGKKHSIIIVAEGVGSGVEFGKKIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQKMYLLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtataggtgtattaacaagtggcggagattcaccaggtatgaatgcggcgatc
cgcgccgtcgtccgcaaggcgatttaccatggagtagaagtatatggagtgtaccatggg
tatgctggtttaatcgctggaaaaataaaaaagttggaagtgggagatgtcggcgacatc
atccaccgcgggggaacgatactgtatacggcgcgctgtccggaatttaagacagaagag
gggcagttaaaagggattgaacaattgaaaaaatacggcatcgaaggattagtcgtgatt
ggtggggacggttcctaccaaggagcgaaaaagctaacagagcacggttttccttgtgtc
ggagtgccgggaacgattgacaatgacattcctggaacggattttacgattggatttgac
acggcgttaaatactgtaattgacgcgatcgacaaaattcgcgataccgctacatcacat
gaacggacatatgtaattgaagtaatgggacgccacgccggggatattgcgttatggtca
gggcttgccggaggggcggaaacgattttgattccagaagctgattacgatatggatgat
gttattgctcggttaaaacgcggacatgaacgcggcaaaaagcatagcattattatcgtt
gccgaaggtgtcggaagcggggtcgaatttggcaagaaaattcaagaagcgacagggttt
gaaacgcgcgttaccgtactggggcatgtgcagcgcggtggttctccaaccgcatttgac
cgcgtgttggccagccgtttaggtgctcgggcagtagaactattattagaaggcaaaggc
ggccgctgcgttggcatccaaaataatcagcttgtcgaccatgatattgcggaagcgttg
gccaacaaacatactattgatcaaaaaatgtatttgttgtcaaaagagctatccatttag

DBGET integrated database retrieval system