KEGG   Geobacillus thermoglucosidasius: Geoth_0923Help
Entry
Geoth_0923        CDS       T01531                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Geoth_0923
Enzymes [BR:gth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Geoth_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
898027..899112
Genome map
AA seq 361 aa AA seqDB search
MAKLDATLTMLKELTDAKGVPGNEREAREVMKKYITPYADEVTTDGLGSLIAKKEGNSNG
PKIMVAGHLDEVGFMVTQIDEKGFIRFQTLGGWWSQVMLAQRVTILTRKGEITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDSIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKDAAHPNVVYGVGTVQEEVGLRGARTAAHFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLRDFVIDVAEELNIPYHFDAMPGGGT
DAGAIHLTASGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDAEKVKQITF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttgatgcaacattaacaatgctaaaagaattgacggacgctaaaggcgtt
ccgggcaatgaacgggaagcgcgcgaagtaatgaaaaagtacataactccttatgccgat
gaagtaacgacagacggtcttggcagtttaatcgcaaaaaaggaaggaaatagcaatggc
cccaaaattatggttgccggccatttagacgaagttggctttatggtgacgcaaatcgat
gagaaaggatttatccgctttcaaacgttaggcggctggtggagccaagtcatgcttgca
cagcgcgtcaccattttaacgcgcaaaggagaaattaccggcgtcatcggttcgaaaccg
ccgcacattttgccaccggaagcgcgcaaaaagccagtcgaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagctatggaatggggcgtgcgcccgggcgactcg
atcgttccgtattttgagtttaccgtgttgaacaatgaaaaaatgctgcttgcgaaagca
tgggataaccggatcggctgcgcggttgcgattgatgtgctcaagcaattaaaagatgct
gctcatccaaacgtcgtgtacggtgtcggcacggtgcaggaagaagtcggtttgcgcggg
gcgagaacggcagcgcatttcattcagccggatatcgcttttgctgtggatgtcggcatt
gctggcgatacgccaggcgtttccgaaaaagaagcgatgggcaagcttggcgccggaccg
cacattgtgttgtacgacgcaacaatggtgtcccatcgcggtttgcgcgattttgtcatt
gatgtcgctgaagaactcaacattccttaccattttgacgcgatgccgggcggcggcact
gacgctggcgcgatccatttaacggcaagcggcgtgccgtcattgacgatcgcgattccg
acacgctacatccattcccatgcggcgattttgcaccgtgacgattacgaaaatacggta
aaattgcttgtcgaagtcatcaagcgtttagacgcggaaaaagtaaaacaaattaccttt
gaataa

DBGET integrated database retrieval system