KEGG   Geobacillus thermoglucosidasius: Geoth_0923Help
Entry
Geoth_0923        CDS       T01531                                 

Definition
(GenBank) Cellulase
Organism
gth  Parageobacillus thermoglucosidasius
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
898027..899112
Genome map
AA seq 361 aa AA seqDB search
MAKLDATLTMLKELTDAKGVPGNEREAREVMKKYITPYADEVTTDGLGSLIAKKEGNSNG
PKIMVAGHLDEVGFMVTQIDEKGFIRFQTLGGWWSQVMLAQRVTILTRKGEITGVIGSKP
PHILPPEARKKPVEIKDMFIDIGATSREEAMEWGVRPGDSIVPYFEFTVLNNEKMLLAKA
WDNRIGCAVAIDVLKQLKDAAHPNVVYGVGTVQEEVGLRGARTAAHFIQPDIAFAVDVGI
AGDTPGVSEKEAMGKLGAGPHIVLYDATMVSHRGLRDFVIDVAEELNIPYHFDAMPGGGT
DAGAIHLTASGVPSLTIAIPTRYIHSHAAILHRDDYENTVKLLVEVIKRLDAEKVKQITF
E
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttgatgcaacattaacaatgctaaaagaattgacggacgctaaaggcgtt
ccgggcaatgaacgggaagcgcgcgaagtaatgaaaaagtacataactccttatgccgat
gaagtaacgacagacggtcttggcagtttaatcgcaaaaaaggaaggaaatagcaatggc
cccaaaattatggttgccggccatttagacgaagttggctttatggtgacgcaaatcgat
gagaaaggatttatccgctttcaaacgttaggcggctggtggagccaagtcatgcttgca
cagcgcgtcaccattttaacgcgcaaaggagaaattaccggcgtcatcggttcgaaaccg
ccgcacattttgccaccggaagcgcgcaaaaagccagtcgaaatcaaagatatgttcatc
gacatcggcgcgacaagccgcgaggaagctatggaatggggcgtgcgcccgggcgactcg
atcgttccgtattttgagtttaccgtgttgaacaatgaaaaaatgctgcttgcgaaagca
tgggataaccggatcggctgcgcggttgcgattgatgtgctcaagcaattaaaagatgct
gctcatccaaacgtcgtgtacggtgtcggcacggtgcaggaagaagtcggtttgcgcggg
gcgagaacggcagcgcatttcattcagccggatatcgcttttgctgtggatgtcggcatt
gctggcgatacgccaggcgtttccgaaaaagaagcgatgggcaagcttggcgccggaccg
cacattgtgttgtacgacgcaacaatggtgtcccatcgcggtttgcgcgattttgtcatt
gatgtcgctgaagaactcaacattccttaccattttgacgcgatgccgggcggcggcact
gacgctggcgcgatccatttaacggcaagcggcgtgccgtcattgacgatcgcgattccg
acacgctacatccattcccatgcggcgattttgcaccgtgacgattacgaaaatacggta
aaattgcttgtcgaagtcatcaagcgtttagacgcggaaaaagtaaaacaaattaccttt
gaataa

DBGET integrated database retrieval system