KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0949Help
Entry
Geoth_0949        CDS       T01531                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00071  Fatty acid degradation
gth00362  Benzoate degradation
gth01100  Metabolic pathways
gth01120  Microbial metabolism in diverse environments
gth01212  Fatty acid metabolism
Module
gth_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Geoth_0949
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geoth_0949
Enzymes [BR:gth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Geoth_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Skp1 DUF4919
Motif
Other DBs
NCBI-ProteinID: AEH46947
Position
924866..925639
Genome map
AA seq 257 aa AA seqDB search
MEFFRVHKEEFVADVAFSRPPANALSSAVLKELSSLLDELEADENVRVVLLHGEGRFFSA
GADIKEFTSIKSSEEAVKLSKTGQQVLERIERFTKPVIAAVHGAALGGGLELAMSCHVRI
VSENAKLGLPELQLGIIPGFAGTQRLPRYVGFSKAAEMMWTSEPITGTEAVQWGLASKAV
PEEQLLEEAKKLAKKIAQKSPISIRATLQLLNAFKEKSFQEAVREEAELFGSVFTTEDAK
EGVQAFIEKRPPSFQGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggaattttttcgcgttcataaagaagagtttgttgcggacgtggcgttttcccgtcct
ccggcaaacgctctttcatctgcagttttgaaagagctttcatcattgctggatgagctg
gaggcggatgaaaatgtccgcgtcgtgcttcttcatggtgaggggagatttttctcggca
ggtgccgatattaaagagtttacatccataaaatccagcgaagaagccgtaaagctgtca
aaaactggccagcaagtattggagcgcatcgagaggtttacaaagcctgtgattgcggcg
gtccatggcgcggcattaggcggcggattggagctggcgatgagctgccacgttcgcatt
gtttccgaaaacgcaaaactcggattgccggagctgcagcttggcattatacctggcttt
gccggaacccagcggcttccccgctatgtcggtttcagcaaagcggccgagatgatgtgg
acgagcgaaccgattactggaacggaagcggtgcaatggggattggcaagcaaggcggtg
ccggaagaacaactgttggaggaagcaaaaaaactggcgaaaaaaatcgcgcaaaaaagc
ccgatttcgattcgcgcgacattgcagcttttaaacgcctttaaagaaaaatcgttccaa
gaagcggtgcgcgaggaagcggaattgtttggaagtgtgtttacgacagaagacgcgaaa
gaaggagtgcaggcatttattgaaaaacgcccgccatcctttcaggggaaatga

DBGET integrated database retrieval system