KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_0996Help
Entry
Geoth_0996        CDS       T01531                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00860  Porphyrin and chlorophyll metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Geoth_0996
Enzymes [BR:gth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Geoth_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEH46994
Position
975114..975914
Genome map
AA seq 266 aa AA seqDB search
MASGPLSGKTVLVTREKEQAKAFSEKLREAGAIPVEIPLIAISPSSHHEEIERCARQLSD
YDWLVFTSANGVRFFFPFVKQKTLLPKVVVVGKKTAAALKAYGVSPAVVPDEFVAEGVIE
ALKPLVKPRDRVLLVKGNLARTVLRDALIDMGADVTDLIVYKTSMNEAGKERLLCLLREK
KLDVITFTSSSTVQSFLRMMEREDIASLLAGCAVACIGPITKETAEKAGLSVHICPSEYT
IDAMIKEMEAYFARCDGGKINGNITI
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcggtccgttgtcgggaaaaacggtgcttgtgacaagggaaaaagaacaggca
aaagcgttttccgaaaagctgcgtgaagccggggcgattccggtagaaattccgcttatt
gcgatttctccttcttcccatcatgaagaaatcgagcggtgtgcacgccagctttccgat
tatgattggctcgttttcacaagcgcgaacggcgtgcggtttttcttcccgtttgtcaaa
cagaaaacgctgcttccaaaagtggtggtcgtcggcaaaaaaacggcagcggcgttaaaa
gcatatggcgtttctcctgccgtcgtccctgacgaatttgtggccgaaggtgtcatcgag
gcgctaaaaccgcttgtgaagccgcgcgatcgcgtgcttttagtcaaagggaatttggca
aggacggtattgcgggatgcgctaatcgacatgggggcagacgtaacggaccttattgtg
tataaaacgtcgatgaacgaagcaggaaaagaacgattgctatgcctgctccgggaaaaa
aaactcgatgtcattacgtttacaagctcttcaactgtacaaagctttctgcggatgatg
gaaagagaagatatcgcttcattgcttgccggctgtgcggttgcctgcatcggcccgatt
acgaaggagacggcggaaaaagcggggctttccgtgcatatttgtccaagcgagtatacg
attgatgctatgataaaagagatggaggcatatttcgcaagatgtgatggagggaaaata
aatggaaacattacgatttga

DBGET integrated database retrieval system