KEGG   Geobacillus thermoglucosidasius: Geoth_1233Help
Entry
Geoth_1233        CDS       T01531                                 

Definition
ROK family glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geoth_1233
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_1233
   00052 Galactose metabolism
    Geoth_1233
   00500 Starch and sucrose metabolism
    Geoth_1233
   00520 Amino sugar and nucleotide sugar metabolism
    Geoth_1233
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Geoth_1233
   00524 Butirosin and neomycin biosynthesis
    Geoth_1233
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Geoth_1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1183067..1184032
Genome map
AA seq 321 aa AA seqDB search
MTDMTEKWLVGVDLGGTTTKMAFLTEDGDIVHKWEIGTDISNKGENIVRHIAQSLEDTLH
RLGESKERLLAIGIGAPGPVQRETGMLYEAVNLGWKNYPLKERLERETSLPVAVDNDANI
AALGEMWKGAGNGARDLICVTLGTGVGGGVIANGQIVHGVNGAGGEIGHMTLVAKGGAPC
NCGKTGCLETIASATGIVRIAKEKLSQWDKPTLLRGETITAKAVFDAAKANDELALAIVD
EVMFYLGLALANAANVSNPEKIVIGGGVSKAGNILVERVGAYFRRFAFPRVAEGATIALA
TLGNDAGVIGGAWLAKTSLHI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacggacatgacggaaaaatggcttgttggcgttgatttaggcggaacaacgacgaaa
atggcgtttttaacagaagatggtgatattgtacataaatgggagattggtacagatatt
tccaacaagggggaaaacatcgtcagacatattgcgcaatcgctagaagacacgttgcat
cgcttaggagaaagcaaggaacggcttttagcgatcgggattggcgcgccaggcccggtg
caaagggaaacagggatgctttatgaagcagtgaacttaggatggaaaaattatcctctc
aaagaacggttagagcgggaaacctctcttcctgtagcggtagataatgacgcgaatatt
gctgcgcttggagaaatgtggaaaggagccggtaacggcgcgcgcgatcttatttgcgtg
acacttggcaccggcgtcggcggcggagtgatcgccaatggtcaaattgtgcatggcgtc
aacggcgctggcggagaaatcggccacatgacattggttgccaaaggcggcgcgccgtgt
aattgcggcaaaaccggatgtttagaaacgattgcttctgcgacgggaattgtgcgaatt
gcgaaagaaaaattgtcacagtgggacaagccgactttgcttcgcggtgaaactatcacc
gcgaaagcggtgttcgatgcggcgaaagcgaatgacgaactggcgctcgcaattgtggat
gaagtgatgttttacctaggattagcgttggcgaatgcggcgaacgtgtccaatccggaa
aaaatcgtaattggcggcggcgtgtcaaaagcaggaaatatattggtggaacgcgtcggt
gcttatttccgccgctttgcgtttccgcgtgtcgcggaaggggcgacgattgctctggca
acacttggaaacgacgcgggagtaatcggcggcgcatggctggcgaaaacgtcgctccac
atttga

DBGET integrated database retrieval system