KEGG   Geobacillus thermoglucosidasius: Geoth_1470Help
Entry
Geoth_1470        CDS       T01531                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Geoth_1470
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Geoth_1470
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Geoth_1470
Enzymes [BR:gth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Geoth_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1392474..1393688
Genome map
AA seq 404 aa AA seqDB search
MYNVPNENGRFGDFGGKFVPETLMIPLEEIEEELDKALADDAFKAEYMRILQEYSGRPTP
LTFAPNLTKKLNGAKIYLKREDLNHTGAHKINNAIGQALLAKRMGKKKIIAETGAGQHGV
AAATVAAHFGMECIVFMGEEDIKRQELNVFRMKLLGAEVVPVYSGNRTLKDATNEAIRYW
VQHCDDHFYMIGSVVGPHPYPKMVREFQRIIGDEAKRQFLEREGKLPDMIVACVGGGSNA
MGMFYPFLEDDVTLVGVEAAGKGIDTPYHAATITKGTKGVIHGSMTYLLQDEYGQIIEPY
SVSAGLDYPGVGPEHAYLASIGRVRYESVTDAEAIEAFQLLSREEGIIPAIESAHALAKA
VQLAKTMRNDQTVLVCLSGRGDKDVQTMMNYIKGGNDVAIANRH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtataacgttccaaacgaaaacggcagatttggcgattttggcggaaaattcgttccc
gaaacgttaatgattccgctcgaagaaatagaggaagagctcgacaaggcgctcgccgat
gatgcgtttaaagcggaatatatgcgaattttgcaagagtattccggccggccgacgccg
cttacgtttgcgcctaatttaacgaaaaaactaaatggcgcaaaaatttacttgaaacgg
gaagatttaaaccacaccggcgcccataaaatcaataatgcgatcggacaggcactgctc
gctaaacggatgggaaagaaaaaaatcattgccgaaacgggagcagggcagcacggtgtt
gccgcggcgacggtagcagcccacttcggaatggaatgcatcgtatttatgggggaagaa
gatatcaaacggcaggaattgaacgtattccggatgaaattattgggagccgaagttgtt
cccgtttacagcggcaaccgcacattgaaagacgcgacaaatgaagcgattcgctattgg
gtgcaacattgtgatgaccatttctatatgatcggttctgttgtcggcccgcatccgtat
ccaaaaatggtgcgtgaatttcagcggattatcggcgatgaggcgaaacggcaattcctt
gagcgggaaggaaagcttccggatatgatcgtcgcgtgtgtgggcggcggaagcaatgcg
atgggcatgttttatccgtttttggaagatgatgtgacgcttgtcggcgtggaagcggcc
ggaaaaggaatcgacacgccgtatcatgccgcaacgatcacaaaaggaacaaaaggggtc
attcatgggtcgatgacgtatttgttgcaagatgagtacgggcaaattattgaaccgtat
tccgtttcggcaggccttgattatcctggggttggaccggagcacgcttatttggccagc
atcggccgcgttcgttacgaaagcgttacggatgccgaagcgatcgaggcgttccaactg
ctgtcaagggaagaagggatcattccggcgatcgagtcagcgcatgctttggcgaaggcg
gttcagcttgcgaaaacgatgcgaaacgatcaaacggtgctcgtttgcttatcaggccgc
ggcgataaagatgtgcagacaatgatgaattacataaaagggggaaatgatgttgccatt
gctaaccgtcactaa

DBGET integrated database retrieval system