KEGG   Geobacillus thermoglucosidasius: Geoth_1471Help
Entry
Geoth_1471        CDS       T01531                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Geoth_1471
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Geoth_1471
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Geoth_1471
Enzymes [BR:gth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Geoth_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1393663..1394469
Genome map
AA seq 268 aa AA seqDB search
MLPLLTVTKPMFIPFIVAGDPRPDITVELALALQEAGADILELGVPYSDPLADGPIIQRA
AARALRQQMTLQKAIELIPAMRKKGVKIPIIIFTYYNPVLQLGKESFFALAQKNGANGVL
IPDLPFEESAPVRKLGEAAGIPLISLVAPTSKKRIAMIASNAQGFVYCVSSLGVTGVRDT
LPETLHEFLAEVKRHSRVPVVVGFGISKSEQVSMLKHYCDGVVIGSALVQKIEQLSDRLQ
TPEKKEEALAEFRRYARSLAAPLNETVQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttgccattgctaaccgtcactaagccgatgtttatcccgtttattgttgccggagat
ccccgcccggatataacagttgagcttgccttggcgcttcaagaggcgggagccgatatt
ttggaattgggcgtgccgtattccgatccgttagcggatggcccgattattcaacgggcc
gcggcaagagcgttgcgccagcagatgacgctgcaaaaagcgatcgaattaatccctgca
atgcgaaaaaagggcgtaaaaattccgattattatctttacgtattacaatcctgtgtta
caattagggaaagaatccttttttgctttagcgcaaaaaaatggagcgaacggcgtttta
attccggatttgccttttgaagaaagcgccccggttcgcaagcttggcgaagcggcggga
atcccgctgatttcgctcgtggcgccgacatcgaaaaagcgcatcgcaatgatcgcttcc
aatgcgcaaggatttgtatattgcgtttcctctctcggtgtgaccggcgtgcgtgataca
ctgccggaaacattgcacgaatttttggcagaagtaaaacggcatagccgtgttcctgtc
gtcgttggatttggcatttcgaaaagcgaacaagtaagcatgctaaaacattattgtgac
ggggtcgtcatcggcagcgcgctcgtccaaaaaattgaacagcttagcgaccgcttgcaa
acaccggagaaaaaagaggaagcgctcgccgagtttcgccgttacgctcgctcgctggca
gcaccgctcaatgaaacggtgcaataa

DBGET integrated database retrieval system