KEGG   Geobacillus thermoglucosidasius: Geoth_1518Help
Entry
Geoth_1518        CDS       T01531                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Geoth_1518
  Lipid metabolism
   00561 Glycerolipid metabolism
    Geoth_1518
   00600 Sphingolipid metabolism
    Geoth_1518
Enzymes [BR:gth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Geoth_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1434270..1436459
Genome map
AA seq 729 aa AA seqDB search
MGIIYGPIMRIFHLQANDMSYIMQLVGRGYLAHFYWGKRIRKANGSRKLRFLSRPFSPNP
DPSARAFSLDTLPQEYPAYGNTDFRAPAYQVQLENGATISDLRYKTHRIYKGKPKLKGLP
ATYVERENEAETLEIVLEDRVIGLHVTLLYTVYERWNVVTRSARFENRGAERIKLLRALS
MNVDFPHADYEWLHLPGAWGRERAVERRPLVTGIQSVESRRGASSHQQNPFIALLGKNTN
EDVGEVYGFSLVYSGNFLAQVEVDQFQTTRVSMGINPFDFTWLLEPGESFQTPEVVMVYS
DKGLNGMSQTYHQLYRTRLARGAFRDRERPILINNWEATYFHFNEEKILRLAKTAAELGI
ELFVLDDGWFGKRDNDRSSLGDWFVNKQKLPNGLGGLAKNINQMGMKFGLWVEPEMVSVD
SELYRQHPDWCLHVPNRPRSEGRNQLVLDYSRKEVCDYIIQVISDVLASAPISYVKWDMN
RHMTEIGSAALPPERQRETAHRYMLGLYRVMEEITSRFPHVLFESCSGGGGRFDPGMLYY
MPQTWTSDNTDAVSRLKIQYGTSLVYPISAMGAHVSAVPNHQVHRVTSLAMRGHVAMSGN
VGYELDLTKLSETEKQTVKEQVAFYKEIRRLVQFGTFYRILSPFEGNEAAWMFVSEDRSE
ALVAYFRVLAEANVPLSFIRLKGLDPKKDYKLVGSGEIYGGDELMHIGLIVPQRRGDFVS
IIWRLKAAR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggggattatctatggtccaatcatgagaatatttcatctgcaggcaaatgatatgagt
tatataatgcaacttgtcggacgtggatatttagcccacttttactggggaaaaagaatc
cggaaagcgaatggctcgcgaaaactacggtttctcagccgcccgttttctcctaatccc
gatccatccgcccgcgcgttttctttagatacgctgccgcaagaatacccggcgtatggc
aacacggattttcgcgcgccggcgtatcaagtgcaattggaaaacggggcgacgatctcg
gatttgcgctataaaacgcatcgcatttataaaggaaagccaaagttaaaagggctgccg
gccacctatgtcgaacgcgaaaacgaggcggaaacattagaaatcgtattggaagaccgc
gtgatcggattacacgtcacactgctttatacggtgtatgagcggtggaatgtggtgacg
cgttctgcccgctttgaaaaccgcggcgcggaacggatcaagctgttgcgggcgttaagc
atgaatgtcgatttcccgcatgctgactatgaatggctgcatctcccgggagcatggggg
cgggagcgagcagtggaaagacggccgcttgtcaccggcatacagtcggtagaaagccgt
cgcggcgccagcagccaccagcaaaatccatttatcgccttgctggggaaaaatacaaat
gaagatgtcggggaagtatacggctttagccttgtatacagcggcaatttcctcgcccag
gtcgaagtcgatcaattccagacaacgcgtgtatccatgggaatcaatccgtttgacttt
acatggctgttagaaccgggcgagtcgtttcagacgccggaagtcgtgatggtgtattcg
gataaaggattaaatggaatgtcgcaaacttatcatcagctataccgcacccgcctggcg
cgcggagcgttccgcgaccgggagcgcccgattcttattaacaactgggaagcgacgtat
tttcattttaatgaagaaaaaattttgcgccttgcgaaaacagcagcggaattagggatt
gaactgtttgtgcttgatgacggctggtttggcaaacgcgataatgatcgcagttcatta
ggagattggttcgtcaataaacagaagctgccaaatggactaggagggctggcaaaaaac
attaaccaaatgggaatgaagtttggcctatgggtggaaccagaaatggtttccgtcgac
agcgagctgtatcggcagcatccggactggtgccttcatgtgccgaaccgtccgcgttcg
gaagggagaaaccagcttgtattagactattcccgcaaagaagtgtgcgattatatcatt
caagtcatttccgatgtgctagcgagcgcaccgatttcgtatgtcaaatgggatatgaac
cgtcatatgacggaaatcggctctgccgccctgcctccagaacggcagcgcgaaacggct
caccgctacatgctggggttgtaccgcgtcatggaagaaataacgtcccgttttccgcac
gttctgtttgagagctgctcgggcggcggcggccggtttgacccgggcatgctgtactat
atgccgcaaacgtggacgagtgataatacggacgcggtttcccgcttaaaaatccaatac
ggcaccagccttgtttacccaatcagcgcgatgggcgcgcatgtgtcagcggtgccgaac
caccaagttcaccgtgtgacatcgctggcaatgcgcggtcatgtggcgatgtcgggaaac
gttggctatgaactggatttaacgaaactaagtgagacagaaaaacaaacggtaaaagag
caagtggcattttacaaagaaatccgccgtcttgtccaatttgggacgttttaccggata
ctcagcccgtttgaaggcaatgaggcggcatggatgttcgtatccgaggaccgatcagaa
gcattggtcgcctacttccgcgtgctggcggaagcgaatgtgccgctgtcgttcatacgg
ttaaaagggctggatcctaagaaagattacaaactcgtcggcagcggggaaatatatggc
ggcgatgaactgatgcatatagggttaattgtgccgcagcggcgcggcgacttcgttagc
atcatttggcggttaaaagcagctcgttaa

DBGET integrated database retrieval system