KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1554Help
Entry
Geoth_1554        CDS       T01531                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00330  Arginine and proline metabolism
gth00332  Carbapenem biosynthesis
gth01100  Metabolic pathways
gth01130  Biosynthesis of antibiotics
gth01230  Biosynthesis of amino acids
Module
gth_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Geoth_1554
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Geoth_1554
Enzymes [BR:gth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Geoth_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEH47536
Position
complement(1481872..1482993)
Genome map
AA seq 373 aa AA seqDB search
MKKQRIVVKIGSSSLTDAKGALCHEKLLDHVEAIAYMKQLGHEVILITSGAVAAGFGPLG
YPSRPTTTAGKQAAAAVGQGLLMQGYISAFERFGITIGQILLTREDFYSRERFHNLFSTI
TTLLECGVLPIINENDSVSVEELTFGDNDMLSALVSGFLHADALIILTDINGLYDDNPKT
NPNAKKYVFLPEITKEMIEAAGGSGSAVGTGGMKSKLLAAQKALSFGVSVFVGTGKGKEK
LYDILEGKGDGTYIGAPFHGHMQMRKQWIAYHAPVAGQIEIDEGAETALLQRGKSLLPAG
VTAVYGNFAAMDVVEVVNRKGTVIGRGQVYYSSGDLEKVKGLPSNEAKQYSINHRPEVIH
RDNWVSLRKESVI
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagcagcgaatcgtcgtaaaaatcggcagcagttcattgacggatgcaaaaggt
gcgctttgccacgaaaaactgctcgaccatgtcgaagcgatcgcttatatgaaacaatta
ggccatgaagtcattttaattacatcgggcgcggttgccgccggatttggaccgctcggc
tatccatcgcggcctaccaccaccgcaggaaaacaagcggcggcggcagtcgggcaaggg
ctgctaatgcaaggctatatttccgcgttcgaacggttcggcattacgatagggcaaatt
ttattgacaagagaagatttttacagccgcgaacggtttcataatttattttccacgatc
accacattgctggaatgcggggttttgccgatcatcaacgaaaacgactccgtgtccgtc
gaggaattgacgtttggcgacaatgatatgctttccgcgctcgtaagcggctttttgcat
gcggatgcgctcattatcttaaccgatattaacgggttgtacgatgataacccgaaaaca
aatccaaatgcgaaaaaatatgtgtttttgccggaaatcacaaaagaaatgatcgaagcg
gcgggaggcagcggctccgcagtcggaacgggcggcatgaaatcaaaacttctcgccgcg
caaaaagcgctatctttcggcgtgagcgtctttgtcggaacgggcaaaggaaaagaaaaa
ctatatgatattttggaaggaaaaggagacgggacgtatattggcgcgccgtttcacgga
catatgcaaatgcgcaaacaatggattgcgtaccacgcgcccgtggcggggcaaattgaa
attgacgaaggcgcggaaaccgccttgctgcagcgcggcaaaagcttgcttcccgccggc
gtcaccgcggtgtatgggaactttgccgccatggatgtcgtcgaggtcgtcaaccgcaaa
ggaaccgtcatcggccgcgggcaagtgtactactcctccggcgatttagaaaaagtaaaa
gggcttcctagcaatgaagcgaaacaatattcgattaaccatcgtccggaagtgatccac
cgcgataattgggtatcattgcgaaaggagagtgttatataa

DBGET integrated database retrieval system