KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1597Help
Entry
Geoth_1597        CDS       T01531                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth00010  Glycolysis / Gluconeogenesis
gth00020  Citrate cycle (TCA cycle)
gth00620  Pyruvate metabolism
gth01100  Metabolic pathways
gth01110  Biosynthesis of secondary metabolites
gth01120  Microbial metabolism in diverse environments
gth01130  Biosynthesis of antibiotics
gth01200  Carbon metabolism
Module
gth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Geoth_1597
   00020 Citrate cycle (TCA cycle)
    Geoth_1597
   00620 Pyruvate metabolism
    Geoth_1597
Enzymes [BR:gth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Geoth_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AEH47575
Position
1525053..1526306
Genome map
AA seq 417 aa AA seqDB search
MEVKLHDIGEGMTEAVVLSYFVKKGDYVKADQPLVEVQTDKMVAEIPAPAAGIIQDILVP
EGKTISVGTTILTLKATSPPLAEMRSNPPEVPTESTPPFVMKEEKAAFAKRAVERRVLAS
PHTRKIAREHGVDLEQVVGTGRGGRITDEDVYRFIETNNAKQANHLSVAGGDTEVPSFAK
ADDHAPAFSVIPFRGRRKQIAKKMAQSLYTIPHCTHFEEVDVTELIWFREELKQHNFHIS
ATAFFIKALSLALKKFPIFNARLDEECEEIHLKQEHHIGIAVDTEEGLIVPVIKHVESKS
LREIHEEAKRLTKKAQENKLELQEMTGSTFTISNVGPLGGSIGATPIINYPEVALMAFHK
TKKRPVVMENDEIAVRSMMNISMSFDHRIADGATAVAFTNYFVRLIENPKLMLMELV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaagcttcatgatatcggcgaaggaatgaccgaagcagtcgtattaagttat
ttcgttaaaaaaggggactatgtaaaggcagaccagccgctagtcgaagtgcagacagat
aaaatggtggcggaaatacctgcgccagccgcaggcatcatccaagatattctcgttccc
gaaggaaaaacaatttcagttggcacgacgattcttacgttaaaagcaacatcaccgcca
cttgcggaaatgcggtccaatccgccggaagtgccgacagaatccactccaccgtttgtc
atgaaagaagaaaaggcagctttcgctaagcgggcggtagaacggcgcgtgcttgcctca
ccgcatactcggaaaattgcccgcgaacacggggtggatttagaacaagttgttggcaca
ggacgaggcggccgaattaccgacgaagacgtgtaccgctttatcgaaactaacaatgcg
aagcaagcgaatcatttatcagttgcaggcggcgatacggaagttccatcattcgcaaaa
gcggatgaccatgcaccagcgttttctgtcatcccgttccgcggccgccgcaagcaaatc
gcgaaaaaaatggcgcaatcgttatatacgattccgcattgcacacattttgaagaagtc
gatgtcactgagctcatctggttccgtgaagaactgaaacagcacaatttccatatttcc
gcaacggcgtttttcattaaagcattgtcgcttgcgttaaagaagtttccgatatttaat
gccaggcttgatgaagagtgcgaagagatccatcttaaacaagagcatcatatcggcatt
gcagtcgacacagaagaaggattaatcgtgccagtcatcaaacatgtcgaaagcaagtca
ctgcgggagattcatgaagaagcgaaacgtctcacgaaaaaagcgcaagaaaacaaacta
gagctccaagaaatgacaggaagcacatttaccatcagcaatgttggcccgctcggcggc
agcattggtgcaacaccaattattaattatccagaagtggcacttatggcgttccacaaa
acaaaaaaacgtcctgttgtcatggaaaacgatgaaatcgcagtgcgctcaatgatgaac
atctcgatgtcatttgaccatcgcattgccgatggcgcgacagcggtggcgtttaccaac
tatttcgtaagactgattgaaaatccaaaactaatgttaatggagttggtataa

DBGET integrated database retrieval system