KEGG   Geobacillus thermoglucosidasius: Geoth_1712Help
Entry
Geoth_1712        CDS       T01531                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geoth_1712
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Geoth_1712
   00630 Glyoxylate and dicarboxylate metabolism
    Geoth_1712
Enzymes [BR:gth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Geoth_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1636409..1638592
Genome map
AA seq 727 aa AA seqDB search
MGEYVKVGNLQVAKLLYEFINDEVLPGSEVNSETFWKDFETLIADLTPRNKALLARRDEI
QEKINQWHKEHRDNFNKEEYKAFLTEIGYLEPEVDDFEITTEGVDDEIAIQAGPQLVVPV
TNARYALNAANARWGSLYDALYGTDAISEEGGAERGDSYNPVRGAKVIAYAREFLDQAVP
LKEYSHKDAVQYAVVDGKLVVSVDGGKTTTLKEEEKFVGFQGNPENPTAVLLKNNGLHIE
IQIDRSHPVGKTDKAGVKDVYLEAAVTTIMDCEDSVAAVDAEDKVLVYRNLLGLVKGDLT
ATFTKDGKTITRELKPDRVYQTPDGKELTLPGRSLMFVRNVGHLMTNNAILDANGEEVYE
GIIDAVVTSLIMKHSLLGNTRYANSRKGSIYIVKPKMHGSEEVAFANELFDRVEDMLGLK
RNTIKIGVMDEERRTTLNLKNCIYQVKDRIVFINTGFLDRTGDEIHTSMEAGPMIRKNDM
KTSAWLQGYEKSNVSIGLATGFQGRAQIGKGMWAMPDMMAEMLKQKGGQLKAGANTAWVP
SPTAATLHALHYHQINVAEVQEELRKEQKDYRDEILQIPVAVNPQWTPEEIQEELDNNCQ
GILGYVVRWIDQGIGCSKVPDINNIGLMEDRATLRISSQHIANWLHHGICTKEQVLETLK
RMAKVVDEQNAGDPNYRPMAPDYDNSVAFQAACDLIFKGYEQPNGYTEPILHRRRLEAKA
KYAAIQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatacgtaaaagttggaaatctccaagtcgcaaaactgctttatgagtttata
aacgatgaagtgcttccgggaagcgaagtgaacagcgaaacattttggaaagactttgaa
acgctgattgccgatttaacgccgagaaacaaagcgctgcttgcgcgccgcgatgaaatt
caagaaaaaataaatcaatggcataaagagcaccgcgacaattttaacaaggaagaatat
aaagcgtttttaacggagatcggctatttagagccagaagtggacgatttcgagattacc
accgaaggagtggacgatgaaattgccattcaagctggcccgcaattggtcgtgccggtt
acgaatgcccgctatgcgctgaatgcagcgaatgcccgttggggcagcctttatgatgcc
ttatatggaacggacgcgatcagcgaagaaggcggggcagaacgcggtgattcttacaat
ccggtccgtggggcaaaagtaattgcttatgcgcgcgagtttctcgatcaagccgtgccg
ctgaaagaatattcgcacaaagacgctgttcaatatgcggtagttgacggaaaactggta
gtatccgttgacggcggcaagacgacaacgctaaaagaggaagaaaaattcgtcggtttc
caaggaaacccggaaaatccgacggcggttttgttaaaaaataacggtcttcacatcgaa
attcaaattgaccgcagccaccctgtcggaaaaacggataaagcaggtgtgaaagatgtt
tatttagaagcggcggttacgacgattatggactgcgaagattcggtggcggcagttgac
gcggaagataaggtgctcgtataccgcaatttgctcggccttgtcaaaggagatttgacg
gcaacgttcacaaaagacggaaaaacgataacacgcgagctaaaaccggaccgcgtttat
caaacgccggatggtaaagaacttaccctgccaggccgttcgcttatgttcgtccgcaac
gttggccatttgatgacgaacaatgcgattttggatgcaaacggcgaagaagtatatgaa
ggaatcatcgatgcggtcgtgacaagcttaattatgaaacattcgcttcttggcaacacc
cgttacgcaaattcacgcaagggctcgatttatatcgttaagccgaaaatgcatggttct
gaagaagtcgctttcgccaatgaattattcgaccgcgtcgaagatatgcttgggttgaaa
cgcaacacgattaaaatcggcgtcatggacgaagaacgccgcacaacattgaacttgaaa
aactgcatttatcaagtgaaagaccgcatcgtcttcattaatacaggctttttggaccgg
actggcgatgaaatccatacatcaatggaagctggaccgatgattcgcaaaaatgatatg
aaaacatcagcgtggctgcaaggctatgaaaaatcaaacgtcagcattggcttggccact
ggattccaaggccgcgcccaaatcggcaaaggaatgtgggcgatgccggatatgatggcg
gaaatgctaaagcaaaaaggcgggcaactaaaagcgggcgcaaatacggcttgggtgcct
tcgccgacagctgcgacgctgcacgcgcttcactaccatcaaattaacgtcgctgaagtg
caagaggaattgcgaaaagagcagaaagattaccgtgatgaaattttgcaaataccagtt
gccgtgaacccgcaatggacgccggaagaaattcaagaagagcttgataacaactgccaa
ggcatactcggctacgtcgtccgctggatcgaccaagggatcggatgctcgaaggtgccg
gatattaataatatcggcctgatggaagaccgtgcgacattgcggatttccagccaacat
attgcaaactggctccaccacggcatttgcacgaaagaacaagtattggaaacgttaaaa
cggatggcaaaggtcgtcgacgaacaaaacgccggtgatccgaattatcgcccaatggct
cctgactatgacaattcggttgccttccaagcggcgtgcgacttaatatttaaaggttat
gaacagccaaacggctacaccgaaccgattttgcaccgccgccgtttagaggcaaaagca
aaatacgcagccattcaacaataa

DBGET integrated database retrieval system