KEGG   Geobacillus thermoglucosidasius: Geoth_1712Help
Entry
Geoth_1712        CDS       T01531                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Geoth_1712
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Geoth_1712
   00630 Glyoxylate and dicarboxylate metabolism
    Geoth_1712
Enzymes [BR:gth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Geoth_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1636409..1638592
Genome map
AA seq 727 aa AA seqDB search
MGEYVKVGNLQVAKLLYEFINDEVLPGSEVNSETFWKDFETLIADLTPRNKALLARRDEI
QEKINQWHKEHRDNFNKEEYKAFLTEIGYLEPEVDDFEITTEGVDDEIAIQAGPQLVVPV
TNARYALNAANARWGSLYDALYGTDAISEEGGAERGDSYNPVRGAKVIAYAREFLDQAVP
LKEYSHKDAVQYAVVDGKLVVSVDGGKTTTLKEEEKFVGFQGNPENPTAVLLKNNGLHIE
IQIDRSHPVGKTDKAGVKDVYLEAAVTTIMDCEDSVAAVDAEDKVLVYRNLLGLVKGDLT
ATFTKDGKTITRELKPDRVYQTPDGKELTLPGRSLMFVRNVGHLMTNNAILDANGEEVYE
GIIDAVVTSLIMKHSLLGNTRYANSRKGSIYIVKPKMHGSEEVAFANELFDRVEDMLGLK
RNTIKIGVMDEERRTTLNLKNCIYQVKDRIVFINTGFLDRTGDEIHTSMEAGPMIRKNDM
KTSAWLQGYEKSNVSIGLATGFQGRAQIGKGMWAMPDMMAEMLKQKGGQLKAGANTAWVP
SPTAATLHALHYHQINVAEVQEELRKEQKDYRDEILQIPVAVNPQWTPEEIQEELDNNCQ
GILGYVVRWIDQGIGCSKVPDINNIGLMEDRATLRISSQHIANWLHHGICTKEQVLETLK
RMAKVVDEQNAGDPNYRPMAPDYDNSVAFQAACDLIFKGYEQPNGYTEPILHRRRLEAKA
KYAAIQQ
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatacgtaaaagttggaaatctccaagtcgcaaaactgctttatgagtttata
aacgatgaagtgcttccgggaagcgaagtgaacagcgaaacattttggaaagactttgaa
acgctgattgccgatttaacgccgagaaacaaagcgctgcttgcgcgccgcgatgaaatt
caagaaaaaataaatcaatggcataaagagcaccgcgacaattttaacaaggaagaatat
aaagcgtttttaacggagatcggctatttagagccagaagtggacgatttcgagattacc
accgaaggagtggacgatgaaattgccattcaagctggcccgcaattggtcgtgccggtt
acgaatgcccgctatgcgctgaatgcagcgaatgcccgttggggcagcctttatgatgcc
ttatatggaacggacgcgatcagcgaagaaggcggggcagaacgcggtgattcttacaat
ccggtccgtggggcaaaagtaattgcttatgcgcgcgagtttctcgatcaagccgtgccg
ctgaaagaatattcgcacaaagacgctgttcaatatgcggtagttgacggaaaactggta
gtatccgttgacggcggcaagacgacaacgctaaaagaggaagaaaaattcgtcggtttc
caaggaaacccggaaaatccgacggcggttttgttaaaaaataacggtcttcacatcgaa
attcaaattgaccgcagccaccctgtcggaaaaacggataaagcaggtgtgaaagatgtt
tatttagaagcggcggttacgacgattatggactgcgaagattcggtggcggcagttgac
gcggaagataaggtgctcgtataccgcaatttgctcggccttgtcaaaggagatttgacg
gcaacgttcacaaaagacggaaaaacgataacacgcgagctaaaaccggaccgcgtttat
caaacgccggatggtaaagaacttaccctgccaggccgttcgcttatgttcgtccgcaac
gttggccatttgatgacgaacaatgcgattttggatgcaaacggcgaagaagtatatgaa
ggaatcatcgatgcggtcgtgacaagcttaattatgaaacattcgcttcttggcaacacc
cgttacgcaaattcacgcaagggctcgatttatatcgttaagccgaaaatgcatggttct
gaagaagtcgctttcgccaatgaattattcgaccgcgtcgaagatatgcttgggttgaaa
cgcaacacgattaaaatcggcgtcatggacgaagaacgccgcacaacattgaacttgaaa
aactgcatttatcaagtgaaagaccgcatcgtcttcattaatacaggctttttggaccgg
actggcgatgaaatccatacatcaatggaagctggaccgatgattcgcaaaaatgatatg
aaaacatcagcgtggctgcaaggctatgaaaaatcaaacgtcagcattggcttggccact
ggattccaaggccgcgcccaaatcggcaaaggaatgtgggcgatgccggatatgatggcg
gaaatgctaaagcaaaaaggcgggcaactaaaagcgggcgcaaatacggcttgggtgcct
tcgccgacagctgcgacgctgcacgcgcttcactaccatcaaattaacgtcgctgaagtg
caagaggaattgcgaaaagagcagaaagattaccgtgatgaaattttgcaaataccagtt
gccgtgaacccgcaatggacgccggaagaaattcaagaagagcttgataacaactgccaa
ggcatactcggctacgtcgtccgctggatcgaccaagggatcggatgctcgaaggtgccg
gatattaataatatcggcctgatggaagaccgtgcgacattgcggatttccagccaacat
attgcaaactggctccaccacggcatttgcacgaaagaacaagtattggaaacgttaaaa
cggatggcaaaggtcgtcgacgaacaaaacgccggtgatccgaattatcgcccaatggct
cctgactatgacaattcggttgccttccaagcggcgtgcgacttaatatttaaaggttat
gaacagccaaacggctacaccgaaccgattttgcaccgccgccgtttagaggcaaaagca
aaatacgcagccattcaacaataa

DBGET integrated database retrieval system