KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1948Help
Entry
Geoth_1948        CDS       T01531                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Geoth_1948
   00650 Butanoate metabolism
    Geoth_1948
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Geoth_1948
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geoth_1948
   00622 Xylene degradation
    Geoth_1948
   00621 Dioxin degradation
    Geoth_1948
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Geoth_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1860632..1861627
Genome map
AA seq 331 aa AA seqDB search
MKDSFSTQIRARVSVLLNVKVRLKGDNFMSKVKVGILGSGNIGTDLMYKILNNDGHMELS
IIAGIVPESEGLMRARSMGIRASHEGIAAILEDPDVRIVFDATSAKAHRQNAEALRAAGK
IVIDLTPAAIGPFVVPPINLNEHINAWNVNMISCGGQATIPLVYAVSRIVSVQYAEVITT
TASRSIGPGTRQNMDEFTYTTAQGLQSIGGAKIARAIPVINSADPPIIMTNTVYAAVEED
FDEKAIILSIKDMVDEVSKYVPGYRLKATPFIDYRDTPWGRLPVVVILNEVEGSEDFLPA
YAGNLDIMTASARRVGESYAQHLLKMKEVRR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcattttctacacagatcagagccagagtatcggtcctgttgaacgtgaaa
gtcagactgaaaggggacaatttcatgagcaaagtgaaagttggaatcttaggttctggg
aatattggaacggatttgatgtacaaaatccttaataatgacggccatatggaattatct
ataatagctggaatcgtaccggaatcagaaggtcttatgagagcgcgaagcatgggcata
cgagccagccatgaaggaatagcggcgattttggaggatcccgatgtacggattgtcttt
gacgctacgagtgcaaaggcacatcgccaaaatgcggaagcgttacgtgcagcaggaaag
attgtgatagatttgacgcctgccgcaattggccctttcgtggtgcctcccatcaatttg
aatgagcatataaatgcttggaatgttaacatgatttcgtgcggaggacaggcgacaatt
cctctcgtttatgcagtaagtcgcattgtttctgtccaatatgcggaagtcatcacaact
accgccagccgctccataggccccggaacaagacaaaatatggatgagtttacctatact
accgcacaggggctgcaaagcatcggtggtgcgaagatagccagggcaattccggtgatt
aattcagcagatcccccaatcattatgacaaataccgtttatgccgcagtggaagaggat
tttgatgagaaagcgatcattttgtccattaaggacatggtcgatgaagtgtccaaatat
gttcctggatatcgcctcaaagcgactccatttatcgattatcgtgacacaccatgggga
agattgcctgtcgtcgttatcctaaatgaagtcgaaggctcggaagattttcttccagca
tatgctggtaatttagatattatgacagcttcggcacggcgtgttggcgagtcatatgcc
cagcaccttctaaaaatgaaggaggtgagacgatga

DBGET integrated database retrieval system