KEGG   Geobacillus thermoglucosidasius: Geoth_1948Help
Entry
Geoth_1948        CDS       T01531                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Geoth_1948
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Geoth_1948
   00650 Butanoate metabolism
    Geoth_1948
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Geoth_1948
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Geoth_1948
   00622 Xylene degradation
    Geoth_1948
   00621 Dioxin degradation
    Geoth_1948
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Geoth_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1860632..1861627
Genome map
AA seq 331 aa AA seqDB search
MKDSFSTQIRARVSVLLNVKVRLKGDNFMSKVKVGILGSGNIGTDLMYKILNNDGHMELS
IIAGIVPESEGLMRARSMGIRASHEGIAAILEDPDVRIVFDATSAKAHRQNAEALRAAGK
IVIDLTPAAIGPFVVPPINLNEHINAWNVNMISCGGQATIPLVYAVSRIVSVQYAEVITT
TASRSIGPGTRQNMDEFTYTTAQGLQSIGGAKIARAIPVINSADPPIIMTNTVYAAVEED
FDEKAIILSIKDMVDEVSKYVPGYRLKATPFIDYRDTPWGRLPVVVILNEVEGSEDFLPA
YAGNLDIMTASARRVGESYAQHLLKMKEVRR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcattttctacacagatcagagccagagtatcggtcctgttgaacgtgaaa
gtcagactgaaaggggacaatttcatgagcaaagtgaaagttggaatcttaggttctggg
aatattggaacggatttgatgtacaaaatccttaataatgacggccatatggaattatct
ataatagctggaatcgtaccggaatcagaaggtcttatgagagcgcgaagcatgggcata
cgagccagccatgaaggaatagcggcgattttggaggatcccgatgtacggattgtcttt
gacgctacgagtgcaaaggcacatcgccaaaatgcggaagcgttacgtgcagcaggaaag
attgtgatagatttgacgcctgccgcaattggccctttcgtggtgcctcccatcaatttg
aatgagcatataaatgcttggaatgttaacatgatttcgtgcggaggacaggcgacaatt
cctctcgtttatgcagtaagtcgcattgtttctgtccaatatgcggaagtcatcacaact
accgccagccgctccataggccccggaacaagacaaaatatggatgagtttacctatact
accgcacaggggctgcaaagcatcggtggtgcgaagatagccagggcaattccggtgatt
aattcagcagatcccccaatcattatgacaaataccgtttatgccgcagtggaagaggat
tttgatgagaaagcgatcattttgtccattaaggacatggtcgatgaagtgtccaaatat
gttcctggatatcgcctcaaagcgactccatttatcgattatcgtgacacaccatgggga
agattgcctgtcgtcgttatcctaaatgaagtcgaaggctcggaagattttcttccagca
tatgctggtaatttagatattatgacagcttcggcacggcgtgttggcgagtcatatgcc
cagcaccttctaaaaatgaaggaggtgagacgatga

DBGET integrated database retrieval system