KEGG   Geobacillus thermoglucosidasius: Geoth_2090Help
Entry
Geoth_2090        CDS       T01531                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gth  Geobacillus thermoglucosidasius
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gth00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Geoth_2090
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Geoth_2090
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Geoth_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2015772..2016323
Genome map
AA seq 183 aa AA seqDB search
MSIYNYEVTKPNGETVSLSEYKGKVLLIVNTASRCGFTPQFQDLQKLYEKYREYGFEVLG
FPCNQFGGQEPGSSQDAVAFCQRNYGVTFPIFAKIEVNGDNAHPLFQYLKKEAPFKGFDE
TNANGRILKLMIMEKNPEWLVGDEIKWNFTKFLINRDGKVVRRYEPIEEPIDFEQDIAAL
VNA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttacaattatgaagtgacaaaaccaaacggagaaacagtttctttgtctgaa
tataaaggaaaagtgttgctcattgttaatacagcgagccgctgcggatttacaccgcaa
tttcaagatttacaaaaattgtatgaaaaataccgtgaatatggatttgaagttcttggt
tttccgtgcaatcagtttggtgggcaggagccgggaagcagccaagatgccgttgctttc
tgtcaacgaaattacggggtaacttttcctatctttgccaaaattgaagtaaacggcgat
aacgctcacccattatttcaatatttgaaaaaagaagccccattcaaaggatttgacgaa
acaaacgcgaacggaagaattttgaaactgatgattatggaaaaaaacccggaatggttg
gttggggacgaaatcaaatggaacttcaccaaatttctcattaaccgcgacggcaaagtg
gttcgccgatacgaaccaattgaagagccgatcgattttgaacaagacatcgcagcgctt
gtcaacgcctaa

DBGET integrated database retrieval system